CFDP1 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 26636-1-AP (same clone as 26636-1-PBS)

  WB result of CFDP1 antibody (26636-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CFDP1 transfected HEK-293 cells. This data was developed using the same antibody clone with 26636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 26636-1-AP (same clone as 26636-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 26636-1-AP (CFDP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 26636-1-AP (same clone as 26636-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 26636-1-AP (CFDP1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 26636-1-AP (same clone as 26636-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 26636-1-AP (CFDP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26636-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CFDP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26636-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26636-1-PBS targets CFDP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24425

  Product name: Recombinant human CFDP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 172-299 aa of BC000991

  Sequence: AGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP

• Full Name: craniofacial development protein 1
• Calculated Molecular Weight: 299 aa, 34 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC000991
• Gene Symbol: CFDP1
• Gene ID (NCBI): 10428
• RRID: AB_2880585
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UEE9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.