Properdin/PFC Polyclonal antibody

• 

  WB analysis of Jurkat using 17192-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17192-1-AP (CFP Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  IHC staining of human spleen using 17192-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 17192-1-AP (CFP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 17192-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 17192-1-AP (CFP Antibody) at dilution of 1:50 (under 10x lens).

Properdin/PFC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17192-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

CFP, BFD, Complement factor P, complement factor properdin, PFC

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

17192-1-AP targets Properdin/PFC in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9798

  Product name: Recombinant human CFP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 120-469 aa of BC015756

  Sequence: LEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL

• Full Name: complement factor properdin
• Calculated Molecular Weight: 469 aa, 51 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC015756
• Gene Symbol: CFP
• Gene ID (NCBI): 5199
• RRID: AB_2878359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CFP, also named as Properdin or PFC, is a 469 amino acid protein, which contains 7 TSP type-1 domains. CFP as secreted protein is a positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Properdin deficiency poses a significant risk for severe meningococcal infections (PMID: 22229731). Properdin may be novel biomarker for future risk of type 2 diabetes (PMID: 22338105).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; C-reactive protein (CRP) recognizes uric acid crystals and recruits proteases C1 and MASP1.; Authors - Anika Alberts
human	IHC	J Cancer; CFP is a prognostic biomarker and correlated with immune infiltrates in Gastric Cancer and Lung Cancer.; Authors - Guoliang Cui
human	WB	Cell Death Dis; Tension of plus-end tracking protein Clip170 confers directionality and aggressiveness during breast cancer migration; Authors - Yunfeng Hu
human	IF	Adv Sci (Weinh); Exosome-Mediated Lectin Pathway and Resistin-MIF-AA Metabolism Axis Drive Immune Dysfunction in Immune Thrombocytopenia; Authors - Jin Li