Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CHAF1A Polyclonal antibody

CHAF1A Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 17037-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ChIP, ELISA

CAF, CAF 1, CAF 1 subunit A, CAF I 150 kDa subunit, CAF I p150

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HeLa cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17037-1-AP targets CHAF1A in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10536

Product name: Recombinant human CHAF1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 607-956 aa of BC067093

Sequence: EEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS

Predict reactive species
Full Name chromatin assembly factor 1, subunit A (p150)
Calculated Molecular Weight 956 aa, 107 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC067093
Gene Symbol CHAF1A
Gene ID (NCBI) 10036
RRIDAB_2291707
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13111
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromatin assembly factor 1 (CAF1) is the only histone chaperone known to assemble histones H3 and H4 onto newly synthesized DNA both in vitro and in vivo [PMID:17065558]. The 938 amino acid multidomain p150 (CHAF1A) binds via its C-terminal third to p60, which is an essential step for nucleosome assembly because knocking down either subunit disrupts the activity [PMID:14519857]. In addition, CAF1 facilitates DNA synthesis depending on the binding of the N-terminal 31 residues of p150 to the proliferating cell nuclear antigen (PCNA), which acts as a sliding clamp to stimulate the processivity of DNA polymerase [PMID:10648606]. CHAF1A regulates the formation of heterochromatin in mammalian cells during replication and in plants it maintains the transcription of certain subsets of genes. Furthermore, CHAF1A exists in a chromatin-remodeling complex WINAC, which coactivates ligand-induced transactivation function of the vitamin D receptor [PMID:12837248]. CHAF1A protein exists some phosphorylation sites, which may affect its theoretical molecular weight when tested.And a 150 kDa band was recognized (PMID:27445493).

Protocols

Product Specific Protocols
IHC protocol for CHAF1A antibody 17037-1-APDownload protocol
IP protocol for CHAF1A antibody 17037-1-APDownload protocol
WB protocol for CHAF1A antibody 17037-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Struct Mol Biol

Reprogramming of the histone H3.3 landscape in the early mouse embryo.

Authors - Takashi Ishiuchi
humanChIP

EMBO J

Histone chaperone CAF-1 promotes HIV-1 latency by leading the formation of phase-separated suppressive nuclear bodies.

Authors - Xiancai Ma
  • KO Validated
humanIF

Cancers (Basel)

Human Ccr4 and Caf1 Deadenylases Regulate Proliferation and Tumorigenicity of Human Gastric Cancer Cells via Modulating Cell Cycle Progression.

Authors - Xiao-Hui Song
  • KD Validated
mouseWB

J Biol Chem

The histone chaperone Spt6 is required for activation-induced cytidine deaminase target determination through H3K4me3 regulation.

Authors - Nasim A Begum

Oncogene

CHAF1A promotes RAD51 loading and homologous recombination to drive tumor radioresistance.

Authors - Ruru Wang
humanIHC

Front Mol Biosci

An integrated analysis of prognostic mRNA signature in early- and progressive-stage gastric adenocarcinoma

Authors - Xiaoling Hong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Annabel (Verified Customer) (02-12-2026)

Showed a clear single band in B cell lines, treated with activators. Results were as expected from proteomics experiments.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: B Cell lines

Hasan (Verified Customer) (05-17-2023)

HeLa cells were pre-extracted for 5 mins then fixed with 4% PFA for 15 mins. Blocking with 5% FBS for 40 min and primary antibody incubation overnight.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: HeLa cells
CHAF1A Antibody Immunofluorescence validation (1:300 dilution) in HeLa cells (Cat no:17037-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...