CHCHD5 Monoclonal antibody, PBS Only

• 

  WB analysis using 66584-1-Ig (same clone as 66584-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66584-1-Ig (CHCHD5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66584-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66584-1-Ig (same clone as 66584-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66584-1-Ig (CHCHD5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66584-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66584-1-Ig (same clone as 66584-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66584-1-Ig (CHCHD5 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66584-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66584-1-Ig (same clone as 66584-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66584-1-Ig (CHCHD5 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66584-1-PBS in a different storage buffer formulation.

CHCHD5 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66584-1-PBS

Clone No.2G10A7

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

C2orf9, CHCHD5

---

Product Information

66584-1-PBS targets CHCHD5 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22534

  Product name: Recombinant human CHCHD5 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-110 aa of BC004498

  Sequence: MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 5
• Calculated Molecular Weight: 110 aa, 12 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC004498
• Gene Symbol: CHCHD5
• Gene ID (NCBI): 84269
• RRID: AB_2881944
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BSY4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.