CHD7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHD7 Polyclonal antibody, PBS Only (31919-1-PBS)

• 

  WB analysis using 31919-1-AP (same clone as 31919-1-PBS)

  HEK-293T cells were subjected to Tris-Acetate gel system followed by western blot with 31919-1-AP (CHD7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 31919-1-AP (same clone as 31919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 31919-1-AP (CHD7 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 31919-1-AP (same clone as 31919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31919-1-AP (CHD7 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 31919-1-AP (same clone as 31919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31919-1-AP (CHD7 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31919-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 31919-1-AP (same clone as 31919-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CHD7 antibody (31919-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31919-1-PBS in a different storage buffer formulation.

CHD7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31919-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ATP-dependent helicase CHD7, CHD-7, Chromodomain Helicase DNA Binding Protein 7, Chromodomain-helicase-DNA-binding protein 7, EC:3.6.4.12

---

Product Information

31919-1-PBS targets CHD7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36595

  Product name: Recombinant human CHD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-200 aa of BC110818

  Sequence: GLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMMSNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQGHPQHMQQMGSYMARGDFSM

• Full Name: chromodomain helicase DNA binding protein 7
• Observed Molecular Weight: 350 kDa
• GenBank Accession Number: BC110818
• Gene Symbol: CHD7
• Gene ID (NCBI): 55636
• RRID: AB_3670144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9P2D1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Chromodomain helicase DNA-binding protein 7 (CHD7) is an ATP-dependent eukaryotic chromatin remodeling enzyme that regulates nucleosome positioning and alters DNA accessibility, and is essential for organ development.CHD7 is a gene known to be associated with CHARGE syndrome, Kallmann syndrome, and hypogonadotropic hypogonadism, where it is associated with CHARGE syndrome is a congenital multiorgan disorder characterized by eye defects, heart defects, posterior nasal atresia, growth retardation, genital anomalies, ear malformations, and deafness. The effects of CHD7 mutations on inner ear development, neuronal differentiation, cardiovascular development, and regulation of bone lipid homeostasis have been studied.