Tested Applications
| Positive WB detected in | PC-12 cells, mouse adrenal gland tissue, SH-SY5Y cells, rat adrenal gland tissue |
| Positive IHC detected in | human lung cancer tissue, human colon tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue, mouse small intestine tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 3 publications below |
| IF | See 8 publications below |
Product Information
10529-1-AP targets Chromogranin A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0807 Product name: Recombinant human CHGA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 158-457 aa of BC006459 Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG Predict reactive species |
| Full Name | chromogranin A (parathyroid secretory protein 1) |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 70-85 kDa |
| GenBank Accession Number | BC006459 |
| Gene Symbol | Chromogranin A |
| Gene ID (NCBI) | 1113 |
| RRID | AB_2081122 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10645 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Chromogranin A antibody 10529-1-AP | Download protocol |
| IHC protocol for Chromogranin A antibody 10529-1-AP | Download protocol |
| WB protocol for Chromogranin A antibody 10529-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Immunol Enteric nervous system-derived VIP restrains differentiation of LGR5+ stem cells toward the secretory lineage impeding type 2 immune programs | ||
Cell Metab Glycerate from intestinal fructose metabolism induces islet cell damage and glucose intolerance. | ||
Phytomedicine Study on the effects of the atractylodes macrocephala koidz-raphanus sativus l herb pair in alleviating senile constipation via the gut microbiota-SCFAs-5-HT axis | ||
Cell Biosci Profile of chimeric RNAs and TMPRSS2-ERG e2e4 isoform in neuroendocrine prostate cancer | ||
Sci Rep Generation and characterization of CRISPR/Cas9-mediated MEN1 knockout BON1 cells: a human pancreatic neuroendocrine cell line. | ||
Discov Oncol Depiction of neuroendocrine features associated with immunotherapy response using a novel one-class predictor in lung adenocarcinoma |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jianpeng (Verified Customer) (03-20-2026) | very good
|
FH Sai Sindhura (Verified Customer) (01-08-2026) | CHGA antibody works well
|
FH Adam (Verified Customer) (09-25-2025) | Slight background but still sharp bands with no off target bands
|
FH Madeline (Verified Customer) (09-25-2025) | This antibody works very well- I have repurchased several times within the last year. Clear expression in western blot application with good bands.
|
FH balawant (Verified Customer) (07-26-2022) | This Antibody is working great. I have used for colon and colon cancer cell line
|
FH Susmita (Verified Customer) (04-13-2022) | This antibody works excellent.
|
FH James (Verified Customer) (03-31-2021) | Antibody worked well in both recombinant Chromogranin A produced in both HeLa cell lysates and in HEK cells overexpressed with Chromogranin A
|
FH Iram (Verified Customer) (08-14-2020) | Used 1:1000 dilution for immunoblotting. It gives a very clean band.
|































