Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse brain tissue, RAW 264.7 cells |
| Positive IHC detected in | human pancreas tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue |
| Positive IF-Fro detected in | mouse colon tissue |
| Positive FC (Intra) detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14968-1-AP targets Chromogranin B in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6833 Product name: Recombinant human CHGB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 328-677 aa of BC000375 Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG Predict reactive species |
| Full Name | chromogranin B (secretogranin 1) |
| Calculated Molecular Weight | 78 kDa |
| Observed Molecular Weight | 70-100 kDa |
| GenBank Accession Number | BC000375 |
| Gene Symbol | Chromogranin B |
| Gene ID (NCBI) | 1114 |
| RRID | AB_2081138 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05060 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa. It has been shown that CHGB has a clear degradation band at ~50 kDa (https://www.biorxiv.org/content/10.1101/2019.12.28.890053v1.full.pdf).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| IF protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| IHC protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| WB protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
14968-1-AP is an anti-Chromogranin B (CHGB) antibody with 14 total citations. Citations appear in journals including Cell Research, Advanced Science, Diabetes, mBio, Scientific Reports, iScience, BMC Cancer, Journal of Virology, Journal of Biological Chemistry, Journal of Cell Science, Journal of Proteome Research, International Journal of Biochemistry & Cell Biology, and Bioscience, Biotechnology, and Biochemistry. Research fields span metabolic adaptation, cancer (prostate, osteosarcoma, breast), β-cell function, neuroendocrine biology, viral infection, ALS, and neuropsychiatry.
| Species | Application | Title |
|---|---|---|
Cell Res Famsin, a novel gut-secreted hormone, contributes to metabolic adaptations to fasting via binding to its receptor OLFR796 | ||
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Diabetes The Chd4 helicase regulates chromatin accessibility and gene expression critical for β-cell function in vivo | ||
mBio Citrobacter rodentium Infection Induces Persistent Molecular Changes and Interferon Gamma-Dependent Major Histocompatibility Complex Class II Expression in the Colonic Epithelium. | ||
Sci Rep Rifaximin improves anxiety- and depression-like behaviors in rats by regulating NPY in the colon and mPFC. | ||
iScience Endosomal protein DENND10 promotes developmental competence of neurite extension |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. One user successfully applied it for immunohistochemistry on human pancreatic tissue at 1:700 dilution, achieving strong staining of Islets of Langerhans when combined with AF647. Another user used it for immunofluorescence on mouse colonic tissue at 1:50 dilution, reporting very clear staining after just 1 hour of incubation in PBS-T with normal donkey serum. Overall, users report reliable performance across species and applications with good signal clarity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Patricia (Verified Customer) (05-15-2025) | I used the antibody to stain cells within the Islets of Langerhans in pancreatic tissue from organ donors, and it worked very well in combination with AF647.
 |
Julia (Verified Customer) (03-14-2022) | Works very well after 1 hour incubation in PBS-T supplemented with normal donkey serum (secondary also added for an hour). Very clear staining.
|
