Tested Applications
Positive WB detected in | NIH/3T3 cells, mouse brain tissue, RAW 264.7 cells |
Positive IHC detected in | human pancreas tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse colon tissue |
Positive IF-Fro detected in | mouse colon tissue |
Positive FC (Intra) detected in | PC-12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
14968-1-AP targets Chromogranin B in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6833 Product name: Recombinant human CHGB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 328-677 aa of BC000375 Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG Predict reactive species |
Full Name | chromogranin B (secretogranin 1) |
Calculated Molecular Weight | 78 kDa |
Observed Molecular Weight | 70-100 kDa |
GenBank Accession Number | BC000375 |
Gene Symbol | Chromogranin B |
Gene ID (NCBI) | 1114 |
RRID | AB_2081138 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05060 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa. It has been shown that CHGB has a clear degradation band at ~50 kDa (https://www.biorxiv.org/content/10.1101/2019.12.28.890053v1.full.pdf).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
IHC protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
IF protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
J Virol Kaposi's Sarcoma-Associated Herpesvirus Infection Induces the Expression of Neuroendocrine Genes in Endothelial Cells. | ||
J Proteome Res Label-Free LC-MS/MS Proteomic Analysis of Cerebrospinal Fluid Identifies Protein/Pathway Alterations and Candidate Biomarkers for Amyotrophic Lateral Sclerosis. | ||
Biosci Biotechnol Biochem Identification of proteins that bind to the neuroprotective agent neoechinulin A.
| ||
mBio Citrobacter rodentium Infection Induces Persistent Molecular Changes and Interferon Gamma-Dependent Major Histocompatibility Complex Class II Expression in the Colonic Epithelium. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Patricia (Verified Customer) (05-15-2025) | I used the antibody to stain cells within the Islets of Langerhans in pancreatic tissue from organ donors, and it worked very well in combination with AF647.
![]() |
FH Julia (Verified Customer) (03-14-2022) | Works very well after 1 hour incubation in PBS-T supplemented with normal donkey serum (secondary also added for an hour). Very clear staining.
|