Filter: AllWBIHCIF/ICC

WB analysis of NIH/3T3 using 12527-1-AP (same clone as 12527-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
WB analysis of human heart using 12527-1-AP (same clone as 12527-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
WB analysis of human ileum using 12527-1-AP (same clone as 12527-1-PBS)
human ileum tissue were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
WB analysis of human kidney using 12527-1-AP (same clone as 12527-1-PBS)
human kidney tissue were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
WB analysis of human placenta using 12527-1-AP (same clone as 12527-1-PBS)
human placenta tissue were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 12527-1-AP (same clone as 12527-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
WB analysis of human brain using 12527-1-AP (same clone as 12527-1-PBS)
human brain tissue were subjected to SDS PAGE followed by western blot with 12527-1-AP (CHMP2B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12527-1-AP (CHMP2B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12527-1-AP (CHMP2B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12527-1-AP (CHMP2B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12527-1-AP (CHMP2B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 12527-1-AP (CHMP2B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 12527-1-AP (CHMP2B antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 12527-1-AP (CHMP2B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 12527-1-AP (CHMP2B antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 12527-1-AP (CHMP2B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 12527-1-AP (same clone as 12527-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain using 12527-1-AP (CHMP2B antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 12527-1-AP (same clone as 12527-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CHMP2B antibody (12527-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IF Staining of PFA fixed cells using 12527-1-AP (same clone as 12527-1-PBS)
IF result (endosomal stain) of anti-CHMP2B (12527-1-AP) with the cell (PFA fixed) which has been treated with siRNA for VPS4 by Dr. Philip Woodman. This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 12527-1-AP (same clone as 12527-1-PBS)
Immunofluorescent analysis of HepG2 cells, using CHMP2B antibody 12527-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 12527-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

CHMP2B Polyclonal antibody, PBS Only

CHMP2B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12527-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CGI-84, CHMP2.5, chromatin modifying protein 2B, Chromatin-modifying protein 2b, DMT1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12527-1-PBS targets CHMP2B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3222 Product name: Recombinant human CHMP2B protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-213 aa of BC001553 Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Predict reactive species
Full Name	chromatin modifying protein 2B
Calculated Molecular Weight	24 kDa
Observed Molecular Weight	32 kDa
GenBank Accession Number	BC001553
Gene Symbol	CHMP2B
Gene ID (NCBI)	25978
RRID	AB_10603358
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UQN3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2 2, belongs to the chromatin-modifying protein / charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which involves in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways.