CHRM3 Polyclonal antibody

• 

  WB analysis using 21978-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21978-1-AP (CHRM3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21978-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21978-1-AP (CHRM3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 21978-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21978-1-AP (CHRM3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 21978-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21978-1-AP (CHRM3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CHRM3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21978-1-AP

Publications(1)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

HM3

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue, SK-N-SH cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21978-1-AP targets CHRM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17791

  Product name: Recombinant human CHRM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 261-477 aa of BC121026

  Sequence: RTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITK

• Full Name: cholinergic receptor, muscarinic 3
• Calculated Molecular Weight: 590 aa, 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC121026
• Gene Symbol: CHRM3
• Gene ID (NCBI): 1131
• RRID: AB_3085681
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20309
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHRM3 (M3 muscarinic acetylcholine receptor) is a major player in many kinds of cancer (PMID: 26175851). The expression of muscarinic receptors, mainly the CHRM3, is amplified in several types of tumors, including colon cancer, prostate cancer, endometrial carcinoma, and gastric cancer. Colon cancer overexpresses CHRM3, and post-M3R signaling promotes cell growth via the activation of the epidermal growth factor receptors/ERK and protein kinase C/p38 mitogen-activated protein kinase (MAPK) signaling pathways (PMID: 37744266).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Glia; The Histone Methyltransferases EHMT1 and EHMT2 Repress the Expression of Genes Related to Excitability and Cell Death in Oligodendrocyte Progenitors; Authors - Mathilde Pruvost

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hamidreza (Verified Customer) (10-08-2025)

The western blot is attached to this email

• Applications: Western Blot

CHRM3 Antibody Western Blot validation ( dilution) in (Cat no:21978-1-AP)

FH

Yi Han (Verified Customer) (10-08-2025)

Samples used are synaptosome fractions from human neurons (all 6 lanes). Tuj1 as loading control. Clean band corresponding to the right MW.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: human neurons

CHRM3 Antibody Western Blot validation (1:1000 dilution) in human neurons (Cat no:21978-1-AP)