CIR Polyclonal antibody

• 

  WB analysis using 32928-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32928-1-AP (CIR antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

CIR Polyclonal Antibody for WB, ELISA

Cat No. 32928-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CBF1-interacting corepressor, CIR1, Corepressor interacting with RBPJ 1, Recepin

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse heart tissue, mouse liver tissue, mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32928-1-AP targets CIR in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38647

  Product name: Recombinant human CIR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of NM_004882.3

  Sequence: MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDG

• Full Name: CBF1 interacting corepressor
• Calculated Molecular Weight: 52kDa，450aa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: NM_004882.3
• Gene Symbol: CIR
• Gene ID (NCBI): 9541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86X95
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CIR, a protein originally identified as a CBF1-interacting protein and reported to act as a transcriptional corepressor. CIR is a member of the family of SR-related proteins and that CIR plays a role in splicing regulation. In addition to a basic lysine and acidic serine-rich (BA) domain and a zinc knuckle-like motif, CIR has an arginine/serine dipeptide repeat (RS) domain in its C terminal region. The RS domain has been reported to be present in the superfamily of SR proteins, which are involved in splicing reactions (PMID: 15652350).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Annabel (Verified Customer) (12-23-2025)

Strong signal but produces two bands by western blot. However, both go down as expected with treatment, validating our omics results. Imaged using blotting accelerator

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: B Cells

CIR Antibody Western Blot validation (1:1000 dilution) in B Cells (Cat no:32928-1-AP)