Tested Applications
| Positive WB detected in | LNCaP cells, HeLa cells, HEK-293 cells, pig brain tissue, rabbit brain tissue, rat brian tissue, mouse brain tissue, chicken brain tissue, mouse cerebellum tissue |
| Positive IHC detected in | human pancreas cancer tissue, mouse kidney tissue, rat liver tissue, human ovary cancer tissue, mouse liver tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | H9C2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68030-1-Ig targets CISD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit, chicken |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8560 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
| Full Name | CDGSH iron sulfur domain 1 |
| Calculated Molecular Weight | 108 aa, 12 kDa |
| Observed Molecular Weight | 14-17 kDa |
| GenBank Accession Number | BC007043 |
| Gene Symbol | CISD1 |
| Gene ID (NCBI) | 55847 |
| RRID | AB_2918772 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9NZ45 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CISD1 antibody 68030-1-Ig | Download protocol |
| IHC protocol for CISD1 antibody 68030-1-Ig | Download protocol |
| WB protocol for CISD1 antibody 68030-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CISD1 Monoclonal Antibody (1D7E3), catalog number 68030-1-Ig, has 1 total citation. It appears in Advanced Science (2025), where it was used in Western Blot for mouse samples. The cited study investigates how mitochondrial CISD1 modulates microglial metabolic reprogramming to drive stress susceptibility in mice, placing it at the intersection of mitochondrial biology, neuroimmunology, and metabolic regulation.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Mitochondrial CISD1 Modulates Microglial Metabolic Reprogramming to Drive Stress Susceptibility in Mice |
