CISD1 Monoclonal antibody

CISD1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68030-1-Ig
Clone No.1D7E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, ELISA

1D7E3, C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HEK-293 cells, pig brain tissue, rabbit brain tissue, rat brian tissue, mouse brain tissue, chicken brain tissue, mouse cerebellum tissue
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inH9C2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68030-1-Ig targets CISD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8560

Product name: Recombinant human mitoNEET,CISD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-108 aa of BC007043

Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Predict reactive species
Full Name CDGSH iron sulfur domain 1
Calculated Molecular Weight 108 aa, 12 kDa
Observed Molecular Weight 14-17 kDa
GenBank Accession NumberBC007043
Gene Symbol CISD1
Gene ID (NCBI) 55847
RRIDAB_2918772
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZ45
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.

Protocols

Product Specific Protocols
WB protocol for CISD1 antibody 68030-1-IgDownload protocol
IHC protocol for CISD1 antibody 68030-1-IgDownload protocol
IF protocol for CISD1 antibody 68030-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...