Tested Applications
Positive WB detected in | LNCaP cells, HeLa cells, HEK-293 cells, pig brain tissue, rabbit brain tissue, rat brian tissue, mouse brain tissue, chicken brain tissue, mouse cerebellum tissue |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | H9C2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
68030-1-Ig targets CISD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.
Tested Reactivity | human, mouse, rat, pig, rabbit, chicken |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8560 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
Full Name | CDGSH iron sulfur domain 1 |
Calculated Molecular Weight | 108 aa, 12 kDa |
Observed Molecular Weight | 14-17 kDa |
GenBank Accession Number | BC007043 |
Gene Symbol | CISD1 |
Gene ID (NCBI) | 55847 |
RRID | AB_2918772 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9NZ45 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CISD1 antibody 68030-1-Ig | Download protocol |
IHC protocol for CISD1 antibody 68030-1-Ig | Download protocol |
IF protocol for CISD1 antibody 68030-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |