CoraLite® Plus 488-conjugated CISD1 Monoclonal antibody

CISD1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68030
Clone No.1D7E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit, chicken

Applications

IF/ICC, FC (Intra)

EC:2.6.1.3, Cysteine transaminase CISD1, CDGSH iron-sulfur domain-containing protein 1, CDGSH iron sulfur domain 1, C10orf70

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inH9C2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68030 targets CISD1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8560

Product name: Recombinant human mitoNEET,CISD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-108 aa of BC007043

Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Predict reactive species
Full Name CDGSH iron sulfur domain 1
Calculated Molecular Weight 108 aa, 12 kDa
Observed Molecular Weight 14-17 kDa
GenBank Accession NumberBC007043
Gene Symbol CISD1
Gene ID (NCBI) 55847
RRIDAB_2934611
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZ45
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CISD1 antibody CL488-68030Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...