CISD1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68030-1-Ig (same clone as 68030-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68030-1-Ig (CISD1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 68030-1-Ig (same clone as 68030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68030-1-Ig (CISD1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 68030-1-Ig (same clone as 68030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68030-1-Ig (CISD1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68030-1-PBS in a different storage buffer formulation.

• 

  IF Staining of H9C2 using 68030-1-Ig (same clone as 68030-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed H9C2 cells using CISD1 antibody (68030-1-Ig, Clone: 1D7E3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 68030-1-PBS in a different storage buffer formulation.

CISD1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68030-1-PBS

Clone No.1D7E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1D7E3, C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1

---

Product Information

68030-1-PBS targets CISD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8560

  Product name: Recombinant human mitoNEET,CISD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-108 aa of BC007043

  Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

• Full Name: CDGSH iron sulfur domain 1
• Calculated Molecular Weight: 108 aa, 12 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC007043
• Gene Symbol: CISD1
• Gene ID (NCBI): 55847
• RRID: AB_2918772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NZ45
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.