Product Information
68030-1-PBS targets CISD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.
Tested Reactivity | human, mouse, rat, pig, rabbit, chicken |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8560 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
Full Name | CDGSH iron sulfur domain 1 |
Calculated Molecular Weight | 108 aa, 12 kDa |
Observed Molecular Weight | 14-17 kDa |
GenBank Accession Number | BC007043 |
Gene Symbol | CISD1 |
Gene ID (NCBI) | 55847 |
RRID | AB_2918772 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9NZ45 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.