CISD1 Monoclonal antibody, PBS Only

CISD1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 68030-1-PBS
Clone No.1D7E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit, chicken

Applications

WB, IHC, IF/ICC, Indirect ELISA

1D7E3, C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68030-1-PBS targets CISD1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples.

Tested Reactivity human, mouse, rat, pig, rabbit, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8560

Product name: Recombinant human mitoNEET,CISD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-108 aa of BC007043

Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Predict reactive species
Full Name CDGSH iron sulfur domain 1
Calculated Molecular Weight 108 aa, 12 kDa
Observed Molecular Weight 14-17 kDa
GenBank Accession NumberBC007043
Gene Symbol CISD1
Gene ID (NCBI) 55847
RRIDAB_2918772
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZ45
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.

Loading...
||
New chat Able
正在加载,请稍候...