CoraLite® Plus 647-conjugated CISD1 Polyclonal antibody

• 

  FC experiment of HeLa using CL647-16006

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 647 Anti-Human CISD1 (CL647-16006) and HRP-conjugated polymer at dilution 1:1000 (red), or 0.8 ug CoraLite® Plus 647-conjugated Rabbit IgG control Rabbit PolyAb (CL647-30000, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

CISD1 Polyclonal Antibody for FC (Intra)

Cat No. CL647-16006

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

CISD1, Cysteine transaminase CISD1, EC:2.6.1.3, MDS029, MitoNEET, ZCD1, C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-16006 targets CISD1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8680

  Product name: Recombinant human mitoNEET,CISD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC007043

  Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

• Full Name: CDGSH iron sulfur domain 1
• Calculated Molecular Weight: 108 aa, 12 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC007043
• Gene Symbol: CISD1
• Gene ID (NCBI): 55847
• RRID: AB_2934922
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ45
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.