Tested Applications
| Positive WB detected in | mouse kidney tissue, mouse skeletal muscle tissue, rat kidney tissue, rat skeletal muscle tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16006-1-AP targets CISD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8680 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
| Full Name | CDGSH iron sulfur domain 1 |
| Calculated Molecular Weight | 108 aa, 12 kDa |
| Observed Molecular Weight | 14-17 kDa |
| GenBank Accession Number | BC007043 |
| Gene Symbol | CISD1 |
| Gene ID (NCBI) | 55847 |
| RRID | AB_2080268 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZ45 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CISD1 antibody 16006-1-AP | Download protocol |
| IHC protocol for CISD1 antibody 16006-1-AP | Download protocol |
| IP protocol for CISD1 antibody 16006-1-AP | Download protocol |
| WB protocol for CISD1 antibody 16006-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CISD1 (MitoNEET) antibody (Cat# 16006-1-AP) has accumulated 53 citations across high-impact journals including Nature Genetics, Nature Communications, Molecular Cell, Science Advances, EMBO Journal, PNAS, Cell Metabolism, and Journal of Biological Chemistry. Key research fields include mitophagy, mitochondrial quality control, Parkinson's disease, ferroptosis, iron homeostasis, cancer biology, metabolic regulation, neurodegeneration, and inflammatory diseases.
| Species | Application | Title |
|---|---|---|
Cell Metab Basal Mitophagy Occurs Independently of PINK1 in Mouse Tissues of High Metabolic Demand. | ||
Nat Genet Metabolic gene function discovery platform GeneMAP identifies SLC25A48 as necessary for mitochondrial choline import | ||
Mol Neurodegener Mitochondrial CISD1/Cisd accumulation blocks mitophagy and genetic or pharmacological inhibition rescues neurodegenerative phenotypes in Pink1/parkin models | ||
Mol Cell Dynamics of PARKIN-Dependent Mitochondrial Ubiquitylation in Induced Neurons and Model Systems Revealed by Digital Snapshot Proteomics. | ||
Mol Cell Global Landscape and Dynamics of Parkin and USP30-Dependent Ubiquitylomes in iNeurons during Mitophagic Signaling. |
Reviews
What customers say
One reviewer (5/5) used this antibody at a 1:1000 dilution for Western Blot on Drosophila protein lysate and reported that it successfully detects both the monomeric and dimeric forms of the target protein, making it convenient for protein quantification purposes.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shivam (Verified Customer) (11-08-2025) | The antibody is able to detect the both monomeric and dimeric form of the protein. Comes very handy for quantification of the protein as well.
|
