CISD1 Polyclonal antibody

• 

  WB analysis using 16006-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16006-1-AP (CISD1 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 16006-1-AP

  IP result of anti-CISD1 (IP:16006-1-AP, 3ug; Detection:16006-1-AP 1:2000) with HepG2 cells lysate 600ug.

• 

  IHC staining of human pancreas cancer using 16006-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 16006-1-AP (CISD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16006-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CISD1 antibody (16006-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

CISD1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16006-1-AP

Publications(49)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1, EC:2.6.1.3

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse skeletal muscle tissue, rat kidney tissue, rat skeletal muscle tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 42 publications below
• IHC: See 3 publications below
• IF: See 4 publications below
• IP: See 2 publications below

Product Information

16006-1-AP targets CISD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8680

  Product name: Recombinant human mitoNEET,CISD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC007043

  Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

• Full Name: CDGSH iron sulfur domain 1
• Calculated Molecular Weight: 108 aa, 12 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC007043
• Gene Symbol: CISD1
• Gene ID (NCBI): 55847
• RRID: AB_2080268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZ45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Struct Mol Biol; Mechanism and regulation of the Lys6-selective deubiquitinase USP30.; Authors - Malte Gersch
mouse	WB	Cell Metab; Basal Mitophagy Occurs Independently of PINK1 in Mouse Tissues of High Metabolic Demand.; Authors - Thomas G McWilliams
human	WB	Mol Cell; Quantitative proteomics reveal a feedforward mechanism for mitochondrial PARKIN translocation and ubiquitin chain synthesis.; Authors - Alban Ordureau
human	WB	Mol Cell; Dynamics of PARKIN-Dependent Mitochondrial Ubiquitylation in Induced Neurons and Model Systems Revealed by Digital Snapshot Proteomics.; Authors - Alban Ordureau
		Mol Cell; Global Landscape and Dynamics of Parkin and USP30-Dependent Ubiquitylomes in iNeurons during Mitophagic Signaling.; Authors - Alban Ordureau
human	WB	Sci Adv; AMPK/ULK1-mediated phosphorylation of Parkin ACT domain mediates an early step in mitophagy.; Authors - Chien-Min Hung