• Featured Product
  • KD/KO Validated

CISD1 Polyclonal antibody

CISD1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16006-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1, EC:2.6.1.3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse skeletal muscle tissue, rat kidney tissue, rat skeletal muscle tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16006-1-AP targets CISD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8680

Product name: Recombinant human mitoNEET,CISD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-108 aa of BC007043

Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Predict reactive species
Full Name CDGSH iron sulfur domain 1
Calculated Molecular Weight 108 aa, 12 kDa
Observed Molecular Weight 14-17 kDa
GenBank Accession NumberBC007043
Gene Symbol CISD1
Gene ID (NCBI) 55847
RRIDAB_2080268
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NZ45
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity.

Protocols

Product Specific Protocols
IF protocol for CISD1 antibody 16006-1-APDownload protocol
IHC protocol for CISD1 antibody 16006-1-APDownload protocol
IP protocol for CISD1 antibody 16006-1-APDownload protocol
WB protocol for CISD1 antibody 16006-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Struct Mol Biol

Mechanism and regulation of the Lys6-selective deubiquitinase USP30.

Authors - Malte Gersch
mouseWB

Cell Metab

Basal Mitophagy Occurs Independently of PINK1 in Mouse Tissues of High Metabolic Demand.

Authors - Thomas G McWilliams
humanWB

Mol Cell

Quantitative proteomics reveal a feedforward mechanism for mitochondrial PARKIN translocation and ubiquitin chain synthesis.

Authors - Alban Ordureau
humanWB

Mol Cell

Dynamics of PARKIN-Dependent Mitochondrial Ubiquitylation in Induced Neurons and Model Systems Revealed by Digital Snapshot Proteomics.

Authors - Alban Ordureau

Mol Cell

Global Landscape and Dynamics of Parkin and USP30-Dependent Ubiquitylomes in iNeurons during Mitophagic Signaling.

Authors - Alban Ordureau
humanWB

Sci Adv

AMPK/ULK1-mediated phosphorylation of Parkin ACT domain mediates an early step in mitophagy.

Authors - Chien-Min Hung

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shivam (Verified Customer) (11-08-2025)

The antibody is able to detect the both monomeric and dimeric form of the protein. Comes very handy for quantification of the protein as well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Drosophila protein lysate
Loading...
||
New chat

Able

正在加载,请稍候...