CKM/CKB Polyclonal antibody, PBS Only

CKM/CKB Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 15891-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

15891-1-PBS targets CKM/CKB in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8678

Product name: Recombinant human CKM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-381 aa of BC007462

Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Predict reactive species
Full Name creatine kinase, muscle
Calculated Molecular Weight 381 aa, 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC007462
Gene Symbol CKM
Gene ID (NCBI) 1158
RRIDAB_2260647
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06732
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Creatine Kinase, an enzyme important for energy metabolism in cells of high and fluctuating energy requirements, catalyses the reversible transfer of a phosphoryl goup from phosphocreatine to ADP. CK isoenzymes(muscle, brain, sarcomeric, Ubiquitous-type) play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Inactivation of creatine kinase by gliotoxin was accompanied by the formation of a 37-kDa form of the enzyme.This oxidized form of creatine kinase was rapidly reconverted to the 42-kDa species by the addition of reducing agents concomitant with restoration of activity.(PMID: 10827185). This antibody can recognize both CKB and CKM due to the high homology.

Loading...
||
New chat Able
正在加载,请稍候...