CKMT2 Polyclonal antibody

• 

  WB analysis using 13207-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13207-1-AP (CKMT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 13207-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13207-1-AP (CKMT2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 13207-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13207-1-AP (CKMT2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 13207-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13207-1-AP (CKMT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 13207-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13207-1-AP (CKMT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 13207-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13207-1-AP (CKMT2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 13207-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13207-1-AP (CKMT2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CKMT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13207-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

Basic-type mitochondrial creatine kinase, CKMT 2, Creatine kinase S-type, mitochondrial, EC:2.7.3.2, Mib CK

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human heart tissue, human skeletal muscle tissue, mouse skeletal muscle tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

13207-1-AP targets CKMT2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3971

  Product name: Recombinant human CKMT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-419 aa of BC029140

  Sequence: LRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK

• Full Name: creatine kinase, mitochondrial 2 (sarcomeric)
• Calculated Molecular Weight: 419 aa, 48 kDa
• Observed Molecular Weight: 41-48 kDa
• GenBank Accession Number: BC029140
• Gene Symbol: CKMT2
• Gene ID (NCBI): 1160
• RRID: AB_2081188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17540
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CKMT2 (Creatine kinase S-type, mitochondrial), also known as s-MtCK, is one of the creatine kinase (CK) isozymes that are tightly coupled to adenosine triphosphate (ATP) output via adenine nucleotide transport proteins or carriers, making it an important player in ATP synthesis and respiratory chain activity (PMID: 38172162). Enhancing Ckmt2 expression or activity can protect against myocardial injury caused by ischemia-reperfusion injury (PMID: 39457679).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; The phytochemical hyperforin triggers thermogenesis in adipose tissue via a Dlat-AMPK signaling axis to curb obesity.; Authors - Suzhen Chen
chicken	WB	Mol Cell Proteomics; Seminal Plasma Proteome as an Indicator of Sperm Dysfunction and Low Sperm Motility in Chickens; Authors - Yunlei Li
mouse	WB,IHC	Metabolism; Sustained mitochondrial biogenesis is essential to maintain caloric restriction-induced beige adipocytes.; Authors - Raja Gopal Reddy Mooli
human	WB	Front Cell Dev Biol; Hypoxia-immune-related microenvironment prognostic signature for osteosarcoma; Authors - Wenshuo Zhang
chicken	WB	Mol Cell Proteomics; Seminal Plasma Proteome as an Indicator of Sperm Dysfunction and Low Sperm Motility in Chickens.; Authors - Yunlei Li
mouse	WB	J Agric Food Chem; Artepillin C, a key component of Brazilian propolis, induces thermogenesis in inguinal white adipose tissue of mice through a creatine metabolism-related thermogenic pathway.; Authors - Sho Nishikawa

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Neeraj (Verified Customer) (08-19-2025)

This antibody performed very well in validating my Western blot analysis following transfection in cell lines. It demonstrated high specificity, especially when compared to a similar antibody from another supplier, which showed non-specific binding. I also used it for immunofluorescence experiments, and the results were satisfactory, with clear and consistent staining

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:1000 for western blot; 1:200 for Immunostaining
• Cell Tissue Type: Retinal sections, organoids, HEK cell lines