Tested Applications
| Positive WB detected in | mouse heart tissue, human heart tissue, human skeletal muscle tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse heart tissue, rat tongue tissue, human heart tissue, mouse tongue tissue, mouse heart tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | H9C2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13207-1-AP targets CKMT2 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3971 Product name: Recombinant human CKMT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 57-419 aa of BC029140 Sequence: LRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK Predict reactive species |
| Full Name | creatine kinase, mitochondrial 2 (sarcomeric) |
| Calculated Molecular Weight | 419 aa, 48 kDa |
| Observed Molecular Weight | 41-48 kDa |
| GenBank Accession Number | BC029140 |
| Gene Symbol | CKMT2 |
| Gene ID (NCBI) | 1160 |
| RRID | AB_2081188 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17540 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CKMT2 (Creatine kinase S-type, mitochondrial), also known as s-MtCK, is one of the creatine kinase (CK) isozymes that are tightly coupled to adenosine triphosphate (ATP) output via adenine nucleotide transport proteins or carriers, making it an important player in ATP synthesis and respiratory chain activity (PMID: 38172162). Enhancing Ckmt2 expression or activity can protect against myocardial injury caused by ischemia-reperfusion injury (PMID: 39457679).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CKMT2 antibody 13207-1-AP | Download protocol |
| IHC protocol for CKMT2 antibody 13207-1-AP | Download protocol |
| WB protocol for CKMT2 antibody 13207-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CKMT2 Polyclonal antibody (Cat# 13207-1-AP) has 13 citations published in journals including Cell Metabolism, Science Translational Medicine, Metabolism, Molecular & Cellular Proteomics, Journal of Agricultural and Food Chemistry, International Journal of Molecular Sciences, Frontiers in Cell and Developmental Biology, Scientific Reports, Journal of Microbiology and Biotechnology, PeerJ, and Translational Cancer Research. Research fields span thermogenesis and adipose biology, mitochondrial function, type 2 diabetes, sperm proteomics, osteosarcoma, colorectal cancer, and energy metabolism.
| Species | Application | Title |
|---|---|---|
Cell Metab Single-nucleus transcriptomics identifies separate classes of UCP1 and futile cycle adipocytes | ||
Cell Metab The phytochemical hyperforin triggers thermogenesis in adipose tissue via a Dlat-AMPK signaling axis to curb obesity. | ||
Metabolism Sustained mitochondrial biogenesis is essential to maintain caloric restriction-induced beige adipocytes. | ||
Sci Transl Med Decreased mitochondrial creatine kinase 2 impairs skeletal muscle mitochondrial function independently of insulin in type 2 diabetes
| ||
Mol Cell Proteomics Seminal Plasma Proteome as an Indicator of Sperm Dysfunction and Low Sperm Motility in Chickens | ||
J Agric Food Chem Artepillin C, a key component of Brazilian propolis, induces thermogenesis in inguinal white adipose tissue of mice through a creatine metabolism-related thermogenic pathway. |
Reviews
What customers say
Customers report strong performance for this antibody in Western blot, immunohistochemistry, and immunofluorescence. One user noted it worked well on aorta tissue at 1:1000 dilution. Another highlighted high specificity in cell line validation after transfection, outperforming a comparable product from another supplier that showed non-specific binding. Immunofluorescence results were described as clear and consistent at 1:200 dilution. Overall ratings average 4.5 out of 5, with users praising specificity and reliable staining across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Juhi (Verified Customer) (11-06-2025) | Works great!
|
Neeraj (Verified Customer) (08-19-2025) | This antibody performed very well in validating my Western blot analysis following transfection in cell lines. It demonstrated high specificity, especially when compared to a similar antibody from another supplier, which showed non-specific binding. I also used it for immunofluorescence experiments, and the results were satisfactory, with clear and consistent staining
|
