Product Information
83028-2-PBS targets CLDN18 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag34049 Product name: Recombinant human CLDN18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-31 aa of NM_001002026 Sequence: MAVTACQGLGFVVSLIGIAGIIAATCMDQWSGSMAVTACQGLGFVVSLIGIAGIIAATCMDQWSGSMAVTACQGLGFVVSLIGIAGIIAATCMDQWS Predict reactive species |
Full Name | claudin 18 |
Calculated Molecular Weight | 28 kDa |
GenBank Accession Number | NM_001002026 |
Gene Symbol | CLDN18 |
Gene ID (NCBI) | 51208 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P56856-2 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |