CLEC4G Polyclonal antibody

• 

  IHC staining of human liver using 18173-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18173-1-AP (CLEC4G antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 18173-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18173-1-AP (CLEC4G antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 18173-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18173-1-AP (CLEC4G Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 18173-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18173-1-AP (CLEC4G Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human liver using 18173-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CLEC4G antibody (18173-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human liver using 18173-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CLEC4G antibody (18173-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

CLEC4G Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 18173-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, IF-P, ELISA

Synonyms

CLEC4G, LP2698, LSECtin, UNQ431

---

Tested Applications

• Positive IHC detected in: human liver tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

18173-1-AP targets CLEC4G in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12837

  Product name: Recombinant human CLEC4G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-293 aa of BC093691

  Sequence: GHDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQESALRELRERVTQGLAEAGRGREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFSVPKTTWAAAQDHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRHNC

• Full Name: C-type lectin domain family 4, member G
• Calculated Molecular Weight: 293 aa, 33 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC093691
• Gene Symbol: CLEC4G
• Gene ID (NCBI): 339390
• RRID: AB_2878512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXB4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLEC4G, also known as LSECtin, is a member of the C-type lectin family of glycan-binding receptors that is expressed on sinusoidal endothelial cells in liver and lymph nodes. CLEC4G is a type II transmembrane protein of ∼40 kDa in size with a single C-type lectin-like domain at the COOH terminus, closest in homology to DC-SIGNR, DC-SIGN, and CD23. CLEC4G has been reported as a receptor for Japanese encephalitis virus (PubMed:24623090), ebolavirus (PubMed:16051304), SARS coronavirus/SARS-CoV (PubMed:16051304), lassa virus and Lymphocytic choriomeningitis virus glycoprotein (PubMed:22156524, PubMed:22673088).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	JHEP Rep; Liver specification of human iPSC-derived endothelial cells transplanted into mouse liver; Authors - Kiryu K Yap