Product Information
24768-1-AP targets CLEC6A in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20695 Product name: Recombinant human CLEC6A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 150-209 aa of BC132935 Sequence: QWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL Predict reactive species |
| Full Name | C-type lectin domain family 6, member A |
| Calculated Molecular Weight | 209 aa, 24 kDa |
| GenBank Accession Number | BC132935 |
| Gene Symbol | CLEC6A |
| Gene ID (NCBI) | 93978 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6EIG7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
