Tested Applications
Positive WB detected in | HL-60 cells, THP-1 cells, U-937 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
22809-1-AP targets Dectin-1 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18924 Product name: Recombinant human CLEC7A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC013385 Sequence: MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAGFKAVEFKG Predict reactive species |
Full Name | C-type lectin domain family 7, member A |
Calculated Molecular Weight | 247 aa, 28 kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | BC013385 |
Gene Symbol | Dectin-1 |
Gene ID (NCBI) | 64581 |
RRID | AB_3085702 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BXN2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Dectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Dectin-1 antibody 22809-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |