CLK3 Polyclonal antibody

• 

  WB analysis using 28037-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28037-1-AP (CLK3 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 28037-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 28037-1-AP (CLK3 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CLK3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28037-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

EC:2.7.12.1, CDC-like kinase 3, CDC like kinase 3

---

Tested Applications

• Positive WB detected in: Jurkat cells, MCF-7 cells, mouse testis tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28037-1-AP targets CLK3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27741

  Product name: Recombinant human CLK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-123 aa of BC002555

  Sequence: MHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASS

• Full Name: CDC-like kinase 3
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC002555
• Gene Symbol: CLK3
• Gene ID (NCBI): 1198
• RRID: AB_3669638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49761
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLK3 (CDC Like Kinase 3) encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that functions on substrates containing serine/threonine and tyrosine. CLK3 modulates RNA splicing by phosphorylating serine/arginine-rich proteins such as SRSF1 and SRSF3. CLK3 dysregulation was indicated to be a high-penetrant factor in different types of human tumors even though its functions in tumors were not clearly characterized (PMID: 32453420). CLK3 has 4 isoforms, which is 74kDa, 59kDa, 56kDa and 18kDa.