Tested Applications
| Positive WB detected in | EC109 cells, K-562 cells, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31205-1-AP targets CLK4 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34446 Product name: Recombinant human CLK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 10-130 aa of NM_020666 Sequence: PDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKS Predict reactive species |
| Full Name | CDC-like kinase 4 |
| Calculated Molecular Weight | 57 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | NM_020666 |
| Gene Symbol | CLK4 |
| Gene ID (NCBI) | 57396 |
| RRID | AB_3669900 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9HAZ1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDC-like kinase 4 (CLK4) is a dual-specificity kinase that can phosphorylate the tyrosine or serine/threonine residues of substrates. CLK4 belongs to the LAMMER kinase family, which includes three other characterised isoforms: CLK1-3. CLK2 and CLK4 are essential regulators of DNA damage-induced IKK and NF-κB activity (PMID: 37506701).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CLK4 antibody 31205-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

