CLK4 Polyclonal antibody

• 

  WB analysis using 31205-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31205-1-AP (CLK4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CLK4 Polyclonal Antibody for WB, ELISA

Cat No. 31205-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CDC like kinase 4, CLK 4

---

Tested Applications

• Positive WB detected in: EC109 cells, K-562 cells, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31205-1-AP targets CLK4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34446

  Product name: Recombinant human CLK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-130 aa of NM_020666

  Sequence: PDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKS

• Full Name: CDC-like kinase 4
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: NM_020666
• Gene Symbol: CLK4
• Gene ID (NCBI): 57396
• RRID: AB_3669900
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9HAZ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDC-like kinase 4 (CLK4) is a dual-specificity kinase that can phosphorylate the tyrosine or serine/threonine residues of substrates. CLK4 belongs to the LAMMER kinase family, which includes three other characterised isoforms: CLK1-3. CLK2 and CLK4 are essential regulators of DNA damage-induced IKK and NF-κB activity (PMID: 37506701).