Tested Applications
Positive WB detected in | mouse eye tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
23994-1-AP targets CLRN2 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21182 Product name: Recombinant human CLRN2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 149-232 aa of BC127863 Sequence: ALAIASFVAAVKFHDLTERIANFQEKLFQFVVVEEQYEESFWICVASASAHAANLVVVAISQIPLPEIKTKIEEATVTAEDILY Predict reactive species |
Full Name | clarin 2 |
Calculated Molecular Weight | 232 aa, 25 kDa |
Observed Molecular Weight | 25 kDa |
GenBank Accession Number | BC127863 |
Gene Symbol | CLRN2 |
Gene ID (NCBI) | 645104 |
RRID | AB_2879393 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | A0PK11 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Clarin 2 belongs to the clarin family of genes. It's a small integral membrane glycoproteins with four transmembrane domains.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CLRN2 antibody 23994-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |