• Featured Product
  • KD/KO Validated

CLTC Monoclonal antibody

CLTC Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66487-1-Ig
Clone No.1B3D7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

1B3D7, CHC, CHC17, Clathrin heavy chain, Clathrin heavy chain 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, Raji cells, rat brain tissue, Jurkat cells, ROS1728 cells, pig brain tissue, HEK-293 cells, K-562 cells, rabbit brain tissue, mouse brain tissue
Positive IHC detected inmouse kidney tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66487-1-Ig targets CLTC in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25040

Product name: Recombinant human CLTC protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-351 aa of BC054489

Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM

Predict reactive species
Full Name clathrin, heavy chain (Hc)
Calculated Molecular Weight 192 kDa
Observed Molecular Weight 170 kDa
GenBank Accession NumberBC054489
Gene Symbol CLTC
Gene ID (NCBI) 1213
RRIDAB_2881852
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ00610
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)

Protocols

Product Specific Protocols
IF protocol for CLTC antibody 66487-1-IgDownload protocol
IHC protocol for CLTC antibody 66487-1-IgDownload protocol
WB protocol for CLTC antibody 66487-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Immunol

Interactome of the Autoimmune Risk Protein ANKRD55.

Authors - Nerea Ugidos
pigWB

Front Microbiol

Porcine Circovirus Type 3 Enters Into PK15 Cells Through Clathrin- and Dynamin-2-Mediated Endocytosis in a Rab5/Rab7 and pH-Dependent Fashion.

Authors - Ruihan Shi
mouseIF

Cell Prolif

Perturbation of intestinal stem cell homeostasis and radiation enteritis recovery via dietary titanium dioxide nanoparticles

Authors - Linpei Zhang
WB,IF

J Virol

Porcine Enteric Alphacoronavirus Entry through Multiple Pathways (Caveolae, Clathrin, and Macropinocytosis) Requires Rab GTPases for Endosomal Transport

Authors - Xiong-Nan Chen
humanWB

iScience

Flat clathrin lattices are linked to metastatic potential in colorectal cancer

Authors - Charlotte Cresens
mouse,humanWB,CoIP

Neuron

Species-specific FMRP regulation of RACK1 is critical for prenatal cortical development

Authors - Minjie Shen
Loading...
||
New chat Able
正在加载,请稍候...