CoraLite® Plus 488-conjugated CLTC Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-66487

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 CLTC antibody (CL488-66487, Clone: 1B3D7 ) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

CLTC Monoclonal Antibody for IF/ICC

Cat No. CL488-66487

Clone No.1B3D7

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Mouse, Rat

Applications

IF/ICC

Synonyms

CHC, CHC17, Clathrin heavy chain 1, clathrin, heavy chain (Hc), CLH 17, CLH17, CLTC, CLTCL2, Hc, KIAA0034

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66487 targets CLTC in IF/ICC applications and shows reactivity with Human, Pig, Mouse, Rat samples.

• Tested Reactivity: Human, Pig, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25040

  Product name: Recombinant human CLTC protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-351 aa of BC054489

  Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM

• Full Name: clathrin, heavy chain (Hc)
• Calculated Molecular Weight: 192 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC054489
• Gene Symbol: CLTC
• Gene ID (NCBI): 1213
• RRID: AB_2883346
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q00610
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)