CLTC Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66487-1-Ig (same clone as 66487-1-PBS)

  WB result of CLTC antibody (66487-1-Ig; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CLTC transfected HeLa cells. This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66487-1-Ig (same clone as 66487-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66487-1-Ig (CLTC antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66487-1-Ig (same clone as 66487-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66487-1-Ig (CLTC antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66487-1-Ig (same clone as 66487-1-PBS)

  HeLa, Jurkat, ROS1728 cells, and pig brain tissue were subjected to SDS PAGE followed by western blot with 66487-1-Ig (CLTC antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66487-1-Ig (same clone as 66487-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66487-1-Ig (CLTC antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66487-1-Ig (CLTC antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CLTC antibody (66487-1-Ig, Clone: 1B3D7 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66487-1-Ig (same clone as 66487-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66487-1-Ig (CLTC antibody), at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66487-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CLTC Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66487-1-PBS

Clone No.1B3D7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1B3D7, CHC, CHC17, Clathrin heavy chain, Clathrin heavy chain 1

---

Product Information

66487-1-PBS targets CLTC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25040

  Product name: Recombinant human CLTC protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-351 aa of BC054489

  Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM

• Full Name: clathrin, heavy chain (Hc)
• Calculated Molecular Weight: 192 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC054489
• Gene Symbol: CLTC
• Gene ID (NCBI): 1213
• RRID: AB_2881852
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q00610
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)