CMIP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CMIP Polyclonal antibody, PBS Only (31407-1-PBS)

• 

  WB analysis using 31407-1-AP (same clone as 31407-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31407-1-AP (CMIP antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31407-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31407-1-AP (same clone as 31407-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31407-1-AP (CMIP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31407-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31407-1-AP (same clone as 31407-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31407-1-AP (CMIP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31407-1-PBS in a different storage buffer formulation.

CMIP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31407-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

TCMIP, Tc Mip, c-Mip, C-Maf-inducing protein, c Mip

---

Product Information

31407-1-PBS targets CMIP in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35679

  Product name: Recombinant human CMIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 8-130 aa of BC038113

  Sequence: KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKCPRL

• Full Name: c-Maf-inducing protein
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC038113
• Gene Symbol: CMIP
• Gene ID (NCBI): 80790
• RRID: AB_3669968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IY22
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cmaf‐inducing protein (CMIP) is a newly identified gene that encodes an 86 kDa protein, containing an N‐terminal pleckstrin homology domain (PH), a nuclear localization signal near the PH domain, a middle region characterized by the presence of several interacting docking sites, including a 14‐3‐3 module, a PKC domain, an Erk domain, an SH3 domain similar to the p85 regulatory subunit of phosphatidylinositol 3‐kinase (PI3K), and a C‐terminal leucine‐rich repeat (LRR) domain.