CNDP2 Polyclonal antibody, PBS Only

CNDP2 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 30025-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30025-1-PBS targets CNDP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32312

Product name: Recombinant human CNDP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 150-305 aa of BC001375

Sequence: TGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSHKKDIL

Predict reactive species
Full Name CNDP dipeptidase 2 (metallopeptidase M20 family)
Calculated Molecular Weight 53 kDa
Observed Molecular Weight 44-53 kDa
GenBank Accession NumberBC001375
Gene Symbol CNDP2
Gene ID (NCBI) 55748
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96KP4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Carnosine dipeptidase II (CNDP2) catalyzes the peptide bond hydrolysis in dipeptides, displaying a non-redundant activity toward threonyl dipeptides. It has high dipeptidase activity toward cysteinyl glycine, an intermediate metabolite in glutathione metabolism (PubMed:19346245, PubMed:12473676). Metabolizes N-lactoyl-amino acids, both through hydrolysis to form lactic acid and amino acids, as well as through their formation by reverse proteolysis (PubMed:25964343). CNDP2 has 2 isoforms with a molecular weight of 53 and 44 kDa. The isoform 1 is ubiquitously expressed with higher levels in the kidney and liver (at protein level) and expressed in peripheral blood leukocytes (PubMed:12473676). It is also expressed in gastric mucosa and down-regulated in gastric cancer mucosal tissues (at the protein level) (PubMed:24395568). Isoform 2 is broadly expressed in fetal tissues and expressed in the adult liver and placenta. (PMID: 17121880).

Loading...
||
New chat Able
正在加载,请稍候...