CNDP2 Polyclonal antibody

• 

  WB analysis using 30025-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30025-1-AP (CNDP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

CNDP2 Polyclonal Antibody for WB, ELISA

Cat No. 30025-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

CN2, CNDP dipeptidase 2, CNDP2, CPGL, FLJ10830, HsT2298, PEPA, Peptidase A

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HL-60 cells, Jurkat cells, PC-3 cells, U-251 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30025-1-AP targets CNDP2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32312

  Product name: Recombinant human CNDP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-305 aa of BC001375

  Sequence: TGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSHKKDIL

• Full Name: CNDP dipeptidase 2 (metallopeptidase M20 family)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 44-53 kDa
• GenBank Accession Number: BC001375
• Gene Symbol: CNDP2
• Gene ID (NCBI): 55748
• RRID: AB_2935503
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KP4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carnosine dipeptidase II (CNDP2) catalyzes the peptide bond hydrolysis in dipeptides, displaying a non-redundant activity toward threonyl dipeptides. It has high dipeptidase activity toward cysteinyl glycine, an intermediate metabolite in glutathione metabolism (PubMed:19346245, PubMed:12473676). Metabolizes N-lactoyl-amino acids, both through hydrolysis to form lactic acid and amino acids, as well as through their formation by reverse proteolysis (PubMed:25964343). CNDP2 has 2 isoforms with a molecular weight of 53 and 44 kDa. The isoform 1 is ubiquitously expressed with higher levels in the kidney and liver (at protein level) and expressed in peripheral blood leukocytes (PubMed:12473676). It is also expressed in gastric mucosa and down-regulated in gastric cancer mucosal tissues (at the protein level) (PubMed:24395568). Isoform 2 is broadly expressed in fetal tissues and expressed in the adult liver and placenta. (PMID: 17121880).