Product Information
13144-1-AP targets CNIH3 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3648 Product name: Recombinant human CNIH3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-136 aa of BC022780 Sequence: AFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAW Predict reactive species |
Full Name | cornichon homolog 3 (Drosophila) |
Calculated Molecular Weight | 160 aa, 19 kDa |
GenBank Accession Number | BC022780 |
Gene Symbol | CNIH3 |
Gene ID (NCBI) | 149111 |
RRID | AB_2081977 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TBE1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |