Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
15015-1-AP targets CNIH4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6965 Product name: Recombinant human CNIH4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC000573 Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLG Predict reactive species |
| Full Name | cornichon homolog 4 (Drosophila) |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16-18 kDa |
| GenBank Accession Number | BC000573 |
| Gene Symbol | CNIH4 |
| Gene ID (NCBI) | 29097 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P003 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CNIH4 (Cornichon Family Member 4) is a protein-coding gene belonging to the cornichon family, which plays a critical role in regulating G protein-coupled receptor (GPCR) trafficking from the endoplasmic reticulum to the cell surface. It facilitates GPCR export through the early secretory pathway and is regulated by TMED9.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CNIH4 antibody 15015-1-AP | Download protocol |
| WB protocol for CNIH4 antibody 15015-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
World J Gastroenterol Genome-wide map of N6-methyladenosine circular RNAs identified in mice model of severe acute pancreatitis. | ||





