CNOT8 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 10752-1-AP (same clone as 10752-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10752-1-AP (same clone as 10752-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 10752-1-AP (same clone as 10752-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 10752-1-AP (same clone as 10752-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 10752-1-AP (same clone as 10752-1-PBS)

  IP result of anti-CNOT8 (IP:10752-1-AP, 4ug; Detection:10752-1-AP 1:600) with mouse testis tissue lysate 4000ug. This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10752-1-AP (same clone as 10752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10752-1-AP (CNOT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10752-1-AP (same clone as 10752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10752-1-AP (same clone as 10752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10752-1-AP (same clone as 10752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10752-1-AP (same clone as 10752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10752-1-AP (same clone as 10752-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CNOT8 antibody (10752-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10752-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CNOT8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10752-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CALIF, CAF2, CAF1-like protein, Caf1b, CAF1 like protein

---

Product Information

10752-1-PBS targets CNOT8 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1201

  Product name: Recombinant human CNOT8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC017366

  Sequence: MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

• Full Name: CCR4-NOT transcription complex, subunit 8
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC017366
• Gene Symbol: CNOT8
• Gene ID (NCBI): 9337
• RRID: AB_2082470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFF9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCR4-NOT transcription complex subunit 8(CNOT8), is a ubiquitous transcription factor, which required for a diverse set of processes. The CCR4-NOT complex is a global regulator of RNA polymerase II, and functions as general transcription regulation complex. It consisted part by CCR4, NOT1 to NOT5, and CAF1. This is a rabbit polyclonal antibody raised against the full-length chain of human CNOT8.