Product Information
23990-1-AP targets CNPY1 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21160 Product name: Recombinant human CNPY1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-45 aa of BC107598 Sequence: MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPL Predict reactive species |
| Full Name | canopy 1 homolog (zebrafish) |
| Calculated Molecular Weight | 92 aa, 11 kDa |
| GenBank Accession Number | BC107598 |
| Gene Symbol | CNPY1 |
| Gene ID (NCBI) | 285888 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q3B7I2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
