Cannabinoid receptor 1 Recombinant monoclonal antibody, PBS Only (Detector)

Cannabinoid receptor 1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 82787-3-PBS
Clone No.250285B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

CNR1, CANN6, cannabinoid receptor 1 (brain), CB R, CB1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82787-3-PBS targets Cannabinoid receptor 1 as part of a matched antibody pair:

MP02192-2: 82787-5-PBS capture and 82787-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12625

Product name: Recombinant human CNR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-121 aa of BC074812

Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV

Predict reactive species
Full Name cannabinoid receptor 1 (brain)
Calculated Molecular Weight 472 aa, 53 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberBC074812
Gene Symbol Cannabinoid receptor 1
Gene ID (NCBI) 1268
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21554
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.

Loading...
||
New chat Able
正在加载,请稍候...