Tested Applications
| Positive WB detected in | HEK-293 cells, SH-SY5Y cells, U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27410-1-AP targets CNTNAP3 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26624 Product name: Recombinant human CNTNAP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 625-695 aa of BC132737 Sequence: TDAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAAGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGT Predict reactive species |
| Full Name | contactin associated protein-like 3 |
| Observed Molecular Weight | 124 kDa |
| GenBank Accession Number | BC132737 |
| Gene Symbol | CNTNAP3 |
| Gene ID (NCBI) | 79937 |
| RRID | AB_2880864 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BZ76 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CNTNAP3 belongs to the Neurexin superfamily and is a member of the Contactin-Associated Protein (CNTNAP) family, which also includes well-studied members like CNTNAP2. CNTNAP3 is predominantly expressed in the central nervous system (CNS), including regions such as the cerebral cortex, hippocampus, and cerebellum. Its expression is primarily in neurons. Compared to its family member CNTNAP2, CNTNAP3 expression begins later in development and persists into adulthood, suggesting roles in both developmental processes and the maintenance of mature neural circuits.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CNTNAP3 antibody 27410-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



