CNTNAP3 Polyclonal antibody

• 

  WB analysis of HEK-293 using 27410-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27410-1-AP (CNTNAP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CNTNAP3 Polyclonal Antibody for WB, ELISA

Cat No. 27410-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CASPR3, CNTNAP3A, Contactin-associated protein-like 3, RP11 138L21.1, RP11 290L7.1

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27410-1-AP targets CNTNAP3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26624

  Product name: Recombinant human CNTNAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 625-695 aa of BC132737

  Sequence: TDAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAAGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGT

• Full Name: contactin associated protein-like 3
• Observed Molecular Weight: 124 kDa
• GenBank Accession Number: BC132737
• Gene Symbol: CNTNAP3
• Gene ID (NCBI): 79937
• RRID: AB_2880864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZ76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CNTNAP3 belongs to the Neurexin superfamily and is a member of the Contactin-Associated Protein (CNTNAP) family, which also includes well-studied members like CNTNAP2. CNTNAP3 is predominantly expressed in the central nervous system (CNS), including regions such as the cerebral cortex, hippocampus, and cerebellum. Its expression is primarily in neurons. Compared to its family member CNTNAP2, CNTNAP3 expression begins later in development and persists into adulthood, suggesting roles in both developmental processes and the maintenance of mature neural circuits.