CNTNAP4 Polyclonal antibody

• 

  WB analysis using 32250-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32250-1-AP (CNTNAP4 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

CNTNAP4 Polyclonal Antibody for WB, ELISA

Cat No. 32250-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CASPR4, Cell recognition molecule Caspr4, Contactin-associated protein-like 4, KIAA1763

---

Tested Applications

• Positive WB detected in: fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32250-1-AP targets CNTNAP4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37716

  Product name: Recombinant human CNTNAP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1135-1241 aa of NM_033401.4

  Sequence: FSAVKSLVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA

• Full Name: contactin associated protein-like 4
• Calculated Molecular Weight: 145kDa，1308aa / 137 kDa，1235aa
• Observed Molecular Weight: 150 kDa, 137 kDa
• GenBank Accession Number: NM_033401.4
• Gene Symbol: CNTNAP4
• Gene ID (NCBI): 85445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9C0A0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Contactin-associated protein-like 4 (Cntnap4) is critical for GABAergic transmission in the brain. Impaired Cntnap4 function is implicated in neurological disorders, such as autism. Loss of Cntnap4 causes pro-inflammatory cognitive decline (PMID: 37933376).