CNTROB Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 26880-1-AP (same clone as 26880-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26880-1-AP (CNTROB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26880-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 26880-1-AP (same clone as 26880-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26880-1-AP (CNTROB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26880-1-PBS in a different storage buffer formulation.

• 

  IF Staining of hTERT-RPE1 using 26880-1-AP (same clone as 26880-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CNTROB antibody (26880-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26880-1-PBS in a different storage buffer formulation.

CNTROB Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26880-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PP1221, LYST-interacting protein 8, LYST interacting protein 8, LIP8, Centrosomal BRCA2-interacting protein

---

Product Information

26880-1-PBS targets CNTROB in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25454

  Product name: Recombinant human CNTROB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC021134

  Sequence: MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTRVLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTRLEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET

• Full Name: centrobin, centrosomal BRCA2 interacting protein
• Calculated Molecular Weight: 903 aa, 101 kDa
• Observed Molecular Weight: 60-70 kDa, 100-130 kDa
• GenBank Accession Number: BC021134
• Gene Symbol: CNTROB
• Gene ID (NCBI): 116840
• RRID: AB_2880667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N137
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.