CNTROB Polyclonal antibody

• 

  WB analysis of mouse brain using 26880-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26880-1-AP (CNTROB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 26880-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 26880-1-AP (CNTROB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of hTERT-RPE1 using 26880-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CNTROB antibody (26880-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CNTROB Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26880-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

PP1221, LYST-interacting protein 8, LYST interacting protein 8, LIP8, Centrosomal BRCA2-interacting protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 4 publications below

Product Information

26880-1-AP targets CNTROB in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25454

  Product name: Recombinant human CNTROB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC021134

  Sequence: MATSADSPSSPLGAEDLLSDSSEPPGLNQVSSEVTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSSAQALEELFPRYTSLRPGPPLNPPDFQGLRDALDSEHTRRKHCERHIQSLQTRVLELQQQLAVAVAADRKKDTMIEQLDKTLARVVEGWNRHEAERTEVLRGLQEEHQAAELTRSKQQETVTRLEQSLSEAMEALNREQESARLQQRERETLEEERQALTLRLEAEQQRCCVLQEERDAARAGQLSEHRELET

• Full Name: centrobin, centrosomal BRCA2 interacting protein
• Calculated Molecular Weight: 903 aa, 101 kDa
• Observed Molecular Weight: 60-70 kDa, 100-130 kDa
• GenBank Accession Number: BC021134
• Gene Symbol: CNTROB
• Gene ID (NCBI): 116840
• RRID: AB_2880667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IF,	J Cell Biol; The central scaffold protein CEP350 coordinates centriole length, stability, and maturation; Authors - Onur Rojhat Karasu
human	IF	Elife; Global cellular response to chemical perturbation of PLK4 activity and abnormal centrosome number.; Authors - Johnny M Tkach
human	IF	Mol Biol Cell; The SON RNA splicing factor is required for intracellular trafficking structures that promote centriole assembly and ciliogenesis.; Authors - Alexander J Stemm-Wolf
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu