Coilin Recombinant monoclonal antibody

• 

  WB analysis using 87171-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87171-1-RR (COIL antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87171-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87171-1-RR (COIL antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 87171-1-RR

  WB result of Coilin antibody (87171-1-RR; 1:300000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Coilin transfected HEK-293 cells.

• 

  IF Staining of HepG2 using 87171-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COIL antibody (87171-1-RR, Clone: 252327B11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 87171-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87171-1-RR against Human Coilin were performed. The affinity constant is below 1 pM.

Coilin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87171-1-RR

Clone No.252327B11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

COIL, CLN80, p80 coilin, p80-coilin

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, NIH/3T3 cells, MCF-7 cells, K-562 cells, C6 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87171-1-RR targets Coilin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1416

  Product name: Recombinant human COIL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 212-576 aa of BC010385

  Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

• Full Name: coilin
• Calculated Molecular Weight: 576 aa, 63 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC010385
• Gene Symbol: COIL
• Gene ID (NCBI): 8161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P38432
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The nuclear coiled body(CBs) and nuclear structures known as gems contain high concentrations of the survival motor neurons (SMN) protein complex. CBs and gems often colocalize, and communication between them is mediated by COIL. COIL is a component of the CBS which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBs disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin, and symmetrical dimethylation of the COIL RG box motif is a molecular switch that determines whether the SMN complex forms gems or becomes incorporated into CBs.