Collagen Type I Monoclonal antibody

• 

  WB analysis of rat skin using 66761-1-Ig

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66761-1-Ig (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Mouse tail using 66761-1-Ig

  Mouse tail tissue were subjected to SDS PAGE followed by western blot with 66761-1-Ig (Collagen Type I antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig skin using 66761-1-Ig

  pig skin tissue were subjected to SDS PAGE followed by western blot with 66761-1-Ig (Collagen Type I antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Collagen Type I Monoclonal Antibody for WB, ELISA

Cat No. 66761-1-Ig

Clone No.3D5E8

Publications(126)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

COL1, COL1A2, 3D5E8, Alpha-2 type I collagen, col I

---

Tested Applications

• Positive WB detected in: rat skin tissue, pig skin tissue, mouse tail tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 102 publications below
• IHC: See 21 publications below
• IF: See 27 publications below

Product Information

66761-1-Ig targets Collagen Type I in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, rabbit, bovine
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6281

  Product name: Recombinant human COL1A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1017-1366 aa of BC054498

  Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK

• Full Name: collagen, type I, alpha 2
• Calculated Molecular Weight: 1366 aa, 130 kDa
• Observed Molecular Weight: 140 kDa, 70-80 kDa
• GenBank Accession Number: BC054498
• Gene Symbol: COL1A2
• Gene ID (NCBI): 1278
• RRID: AB_2882107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08123
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. When MMPs degrade type I collagen, the major degradation products are the typical ¾ and ¼ collagen fragments with molecular weights of ~ 50-70 kDa, and ~ 25 (PMID: 8910479).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Pharm Sin B; Celastrol induces ferroptosis in activated HSCs to ameliorate hepatic fibrosis via targeting peroxiredoxins and HO-1.; Authors - Piao Luo
rat	WB	Adv Healthc Mater; Metformin Carbon Dots for Promoting Periodontal Bone Regeneration via Activation of ERK/AMPK Pathway.; Authors - Chunxia Ren
mouse	WB	Clin Transl Med; Histone methyltransferase KMT2A promotes pulmonary fibrogenesis via targeting pro-fibrotic factor PU.1 in fibroblasts; Authors - Wenting Lyu
mouse	IF	Cell Mol Life Sci; Dysregulated cholesterol uptake and efflux of bone marrow-derived α-SMA+ macrophages contribute to atherosclerotic plaque formation; Authors - Menglu Li
rat	WB	Phytomedicine; β-elemene alleviates hyperglycemia-induced cardiac inflammation and remodeling by inhibiting the JAK/STAT3-NF-κB pathway; Authors - Jiong Wang
rat	WB,IHC	Oxid Med Cell Longev; Eugenol-Preconditioned Mesenchymal Stem Cell-Derived Extracellular Vesicles Promote Antioxidant Capacity of Tendon Stem Cells In Vitro and In Vivo.; Authors - Xiangze Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Su (Verified Customer) (03-18-2022)

Works good and consistent.

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: Cancer tissue

Collagen Type I Antibody Immunohistochemistry validation (1:250 dilution) in Cancer tissue (Cat no:66761-1-Ig)