COL4A3BP Polyclonal antibody, PBS Only

• 

  WB analysis using 15191-1-AP (same clone as 15191-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 15191-1-AP (same clone as 15191-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human pancreas using 15191-1-AP (same clone as 15191-1-PBS)

  human pancreas tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 15191-1-AP (same clone as 15191-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 15191-1-AP (same clone as 15191-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 15191-1-AP (same clone as 15191-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 15191-1-AP (same clone as 15191-1-PBS)

  IP result of anti-COL4A3BP (IP:15191-1-AP, 4ug; Detection:15191-1-AP 1:300) with mouse brain tissue lysate 3680ug. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 15191-1-AP (same clone as 15191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 15191-1-AP (same clone as 15191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15191-1-AP (same clone as 15191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15191-1-AP (same clone as 15191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 15191-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COL4A3BP Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15191-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15191-1-PBS targets COL4A3BP in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7277

  Product name: Recombinant human COL4A3BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 372-598 aa of BC000102

  Sequence: EEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF

• Full Name: collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 80-89 kDa
• GenBank Accession Number: BC000102
• Gene Symbol: COL4A3BP
• Gene ID (NCBI): 10087
• RRID: AB_2082664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5P4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COL4A3BP(Collagen type IV alpha-3-binding protein) is also named as CERT, STARD11. CERT extracts ceramide from the ER and carries it to the Golgi apparatus in a non-vesicular manner and that a particularly efficient cycle of CERT movement for trafficking of ceramide may proceed at membrane contact sites between the ER and the Golgi apparatus(PMID:17314061). This protein has 3 isoforms produced by alternative splicing.