COL4A3BP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COL4A3BP Polyclonal antibody (15191-1-AP)

• Featured Product
• KD/KO Validated

COL4A3BP Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15191-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Ceramide transfer protein, CERT, CERTL, COL4A3BP, GPBP, hCERT, STARD11

• 

  WB analysis using 15191-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 15191-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human pancreas using 15191-1-AP

  human pancreas tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15191-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 15191-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 15191-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 15191-1-AP

  IP result of anti-COL4A3BP (IP:15191-1-AP, 4ug; Detection:15191-1-AP 1:300) with mouse brain tissue lysate 3680ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COL4A3BP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, mouse pancreas tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human pancreas tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15191-1-AP targets COL4A3BP in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7277

  Product name: Recombinant human COL4A3BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 372-598 aa of BC000102

  Sequence: EEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF

• Full Name: collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 80-89 kDa
• GenBank Accession Number: BC000102
• Gene Symbol: COL4A3BP
• Gene ID (NCBI): 10087
• RRID: AB_2082664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5P4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COL4A3BP(Collagen type IV alpha-3-binding protein) is also named as CERT, STARD11. CERT extracts ceramide from the ER and carries it to the Golgi apparatus in a non-vesicular manner and that a particularly efficient cycle of CERT movement for trafficking of ceramide may proceed at membrane contact sites between the ER and the Golgi apparatus(PMID:17314061). This protein has 3 isoforms produced by alternative splicing.

Publications

What published studies show

The COL4A3BP (CERT/STARD11) polyclonal antibody (Cat# 15191-1-AP) has 10 citations spanning journals including Cell Reports, PLoS Biology, Oncogenesis, Journal of Biological Chemistry, eLife, Archives of Biochemistry and Biophysics, Renal Failure, Analyst, Ecotoxicology and Environmental Safety, and Acta Biochimica et Biophysica Sinica. Research fields cover ceramide/lipid transport, oncology (GIST, HCC, prostate cancer), myocardial infarction, diabetic nephropathy, and extracellular vesicle biogenesis.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Golgi retention and oncogenic KIT signaling via PLCγ2-PKD2-PI4KIIIβ activation in gastrointestinal stromal tumor cells; Authors - Yuuki Obata ; KD Validated
	WB	PLoS Biol; Genome-wide identification of modulators of Chlamydia trachomatis parasitophorous vacuole stability highlights an important role for sphingolipid supply; Authors - Mohammed Rizwan Babu Sait
human	WB	Ecotoxicol Environ Saf; The PPARβ/CERK/C1P signaling pathway is a potential mechanism by which antimony exposure promotes prostate cancer cell proliferation; Authors - Jianxi Shi
human,mouse	WB	Oncogenesis; Ablation of sphingosine kinase 2 suppresses fatty liver-associated hepatocellular carcinoma via downregulation of ceramide transfer protein; Authors - Xin Tracy Liu
rat	WB	Acta Biochim Biophys Sin (Shanghai); Exogenous hydrogen sulfide inhibits apoptosis by regulating endoplasmic reticulum stress-autophagy axis and improves myocardial reconstruction after acute myocardial infarction.; Authors - Yaling Li
Mouse	WB	J Biol Chem; StAR-related lipid transfer domain 11 (STARD11)-mediated ceramide transport mediates extracellular vesicle biogenesis.; Authors - Masanori Fukushima