COL4A3BP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COL4A3BP Polyclonal antibody (15191-1-AP)

• 

  WB analysis using 15191-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human pancreas using 15191-1-AP

  human pancreas tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 15191-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 15191-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 15191-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

• 

  WB analysis of mouse kidney using 15191-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15191-1-AP (COL4A3BP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 15191-1-AP

  IP result of anti-COL4A3BP (IP:15191-1-AP, 4ug; Detection:15191-1-AP 1:300) with mouse brain tissue lysate 3680ug.

• 

  IHC staining of human pancreas using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

• 

  IHC staining of human pancreas using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

• 

  IHC staining of human kidney using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

• 

  IHC staining of human kidney using 15191-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney slide using 15191-1-AP (COL4A3BP Antibody) at dilution of 1:50.

• Featured Product
• KD/KO Validated

COL4A3BP Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 15191-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

Ceramide transfer protein, CERT, CERTL, COL4A3BP, GPBP, hCERT, STARD11

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HEK-293 cells, human pancreas tissue, mouse kidney tissue, mouse pancreas tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human pancreas tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 9 publications below

Product Information

15191-1-AP targets COL4A3BP in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7277

  Product name: Recombinant human COL4A3BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 372-598 aa of BC000102

  Sequence: EEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF

• Full Name: collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
• Calculated Molecular Weight: 71 kDa
• Observed Molecular Weight: 80-89 kDa
• GenBank Accession Number: BC000102
• Gene Symbol: COL4A3BP
• Gene ID (NCBI): 10087
• RRID: AB_2082664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5P4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COL4A3BP(Collagen type IV alpha-3-binding protein) is also named as CERT, STARD11. CERT extracts ceramide from the ER and carries it to the Golgi apparatus in a non-vesicular manner and that a particularly efficient cycle of CERT movement for trafficking of ceramide may proceed at membrane contact sites between the ER and the Golgi apparatus(PMID:17314061). This protein has 3 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Mouse	WB	J Biol Chem; StAR-related lipid transfer domain 11 (STARD11)-mediated ceramide transport mediates extracellular vesicle biogenesis.; Authors - Masanori Fukushima
rat	WB	Acta Biochim Biophys Sin (Shanghai); Exogenous hydrogen sulfide inhibits apoptosis by regulating endoplasmic reticulum stress-autophagy axis and improves myocardial reconstruction after acute myocardial infarction.; Authors - Yaling Li
mouse	WB	Ren Fail; LncTUG1 ameliorates renal tubular fibrosis in experimental diabetic nephropathy through the miR-145-5p/dual-specificity phosphatase 6 axis; Authors - Taoxia Wang
	WB	PLoS Biol; Genome-wide identification of modulators of Chlamydia trachomatis parasitophorous vacuole stability highlights an important role for sphingolipid supply; Authors - Mohammed Rizwan Babu Sait
human,mouse	WB	Arch Biochem Biophys; The ceramide transport protein CERT is involved in alkylacylglycerol transfer from the ER to the Golgi for the biosynthesis of ether phospholipid; Authors - Yasuhiro Horibata
human,mouse	WB	Oncogenesis; Ablation of sphingosine kinase 2 suppresses fatty liver-associated hepatocellular carcinoma via downregulation of ceramide transfer protein; Authors - Xin Tracy Liu