COMMD9 Recombinant monoclonal antibody, PBS Only (Detector)

COMMD9 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84251-3-PBS
Clone No.241505E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84251-3-PBS targets COMMD9 as part of a matched antibody pair:

MP01110-1: 84251-2-PBS capture and 84251-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35078

Product name: Recombinant human COMMD9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-198 aa of BC010892

Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Predict reactive species
Full Name COMM domain containing 9
GenBank Accession NumberBC010892
Gene Symbol COMMD9
Gene ID (NCBI) 29099
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P000
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COMMD9, also known as HSPC166, is a member of the COMMD family of proteins. The COMMD protein family is an evolutionarily conserved gene family that plays a role in a number of critical biological processes, including inflammation, copper homeostasis, sodium balance, endosomal sorting and cancer. COMMD9 has been shown to participate in TFDP1/E2F1 activation and to play a critical role in non-small cell lung cancer (PMID: 27871936)

Loading...
||
New chat Able
正在加载,请稍候...