CORO2A Polyclonal antibody

• 

  WB analysis using 28883-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28883-1-AP (CORO2A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 28883-1-AP

  WB result of CORO2A antibody (28883-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CORO2A transfected Jurkat cells.

• 

  IHC staining of human skin cancer using 28883-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 28883-1-AP (CORO2A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 28883-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 28883-1-AP (CORO2A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 28883-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 28883-1-AP (CORO2A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 28883-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 28883-1-AP (CORO2A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CORO2A Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28883-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IHC, ELISA

Synonyms

CLIPINB, CORO2A, Coronin 2A, DKFZp686G19226, IR10, WD repeat containing protein 2, WDR2

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells
• Positive IHC detected in: human skin cancer tissue, mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28883-1-AP targets CORO2A in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29696

  Product name: Recombinant human CORO2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 162-279 aa of BC000010

  Sequence: LDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYD

• Full Name: coronin, actin binding protein, 2A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000010
• Gene Symbol: CORO2A
• Gene ID (NCBI): 7464
• RRID: AB_2881227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92828
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CORO2A (Coronin 2A), also named as CLIPINB, is a member of the 'short' coronin subfamily containing a single WD40-repeat domain. It has been shown that the expression of CORO2A is up-regulated in human colon cancer. CORO2A can interact with MAPK14 and PRMT5. The calculated MW of CORO2A is 60 kDa, while 28883-1-AP antibody detects 48 kDa protein which is similar to the paper published. (PMID: 26373535)