Tested Applications
Positive WB detected in | Jurkat cells, Raji cells |
Positive IHC detected in | human skin cancer tissue, mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
28883-1-AP targets CORO2A in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29696 Product name: Recombinant human CORO2A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 162-279 aa of BC000010 Sequence: LDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYD Predict reactive species |
Full Name | coronin, actin binding protein, 2A |
Calculated Molecular Weight | 60 kDa |
Observed Molecular Weight | 48 kDa |
GenBank Accession Number | BC000010 |
Gene Symbol | CORO2A |
Gene ID (NCBI) | 7464 |
RRID | AB_2881227 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92828 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CORO2A (Coronin 2A), also named as CLIPINB, is a member of the 'short' coronin subfamily containing a single WD40-repeat domain. It has been shown that the expression of CORO2A is up-regulated in human colon cancer. CORO2A can interact with MAPK14 and PRMT5. The calculated MW of CORO2A is 60 kDa, while 28883-1-AP antibody detects 48 kDa protein which is similar to the paper published. (PMID: 26373535)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CORO2A antibody 28883-1-AP | Download protocol |
IHC protocol for CORO2A antibody 28883-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |