COTL1 Polyclonal antibody

• 

  WB analysis using 10781-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10781-1-AP (COTL1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10781-1-AP

  WB result of COTL1 antibody (10781-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-COTL1 transfected HeLa cells.

• 

  IP experiment of mouse kidney using 10781-1-AP

  IP result of anti-COTL1 (IP:10781-1-AP, 3ug; Detection:10781-1-AP 1:3000) with mouse kidney tissue lysate 12500ug.

• 

  IHC staining of human lung cancer using 10781-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10781-1-AP (COTL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 10781-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10781-1-AP (COTL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

COTL1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10781-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CLP, Coactosin like protein, COTL1

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

10781-1-AP targets COTL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1230

  Product name: Recombinant human COTL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC010884

  Sequence: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE

• Full Name: coactosin-like 1 (Dictyostelium)
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC010884
• Gene Symbol: COTL1
• Gene ID (NCBI): 23406
• RRID: AB_2084785
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14019
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COTL1, also named as CLP, binds to F-actin in a calcium-independent manner. And it has no direct effect on actin depolymerization.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	J Proteome Res; Proteomic analysis of human small cell lung cancer tissues: up-regulation of coactosin-like protein-1.; Authors - Jeong Hye-Cheol HC
human	WB	Oncotarget; Genetic and epigenetic silencing of mircoRNA-506-3p enhances COTL1 oncogene expression to foster non-small lung cancer progression.; Authors - Shanqi Guo
human	IHC	J Inflamm Res; Coactosin-Like Protein in Breast Carcinoma: Friend or Foe?; Authors - Bei Wang
human	WB	PLoS One; TDP-43 identified from a genome wide RNAi screen for SOD1 regulators.; Authors - Somalinga Balajee R BR ; KD Validated
human	WB	Exp Lung Res; Exposure to cigarette smoke extract and lipopolysaccharide modifies cytoskeleton organization in bronchial epithelial cells.; Authors - Claudia D'Anna
human	WB	J Investig Med; Differential expression of PAI-RBP1, C1orf142, and COTL1 in non-small cell lung cancer cell lines with different tumor metastatic potential.; Authors - Sun Wenjing W

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Susanne (Verified Customer) (06-29-2019)

Good staining with low background in WB and IF.For IF fixation was done with methanol 10 min at -20°C (pre cool), the antibody was diluted in 1%BSA/PBS.For WB the antibody was diluted in PBST-0,1%/5%skim milk and incubated over night.

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: 1:1000 WB 1:50 IF
• Cell Tissue Type: EBV transformed B cells, CD19+ cells, CD40L/IL-4 stimulated cells

COTL1 Antibody Western Blot,Immunofluorescence, validation (1:1000 WB 1:50 IF dilution) in EBV transformed B cells, CD19+ cells, CD40L/IL-4 stimulated cells (Cat no:10781-1-AP)