Tested Applications
Positive WB detected in | A549 cells, HeLa cells, SH-SY5Y cells |
Positive IHC detected in | human stomach tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 7 publications below |
Product Information
19425-1-AP targets COX16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13756 Product name: Recombinant human COX16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC001702 Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT Predict reactive species |
Full Name | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) |
Calculated Molecular Weight | 106 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC001702 |
Gene Symbol | COX16 |
Gene ID (NCBI) | 51241 |
RRID | AB_10666854 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9P0S2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COX16 antibody 19425-1-AP | Download protocol |
IHC protocol for COX16 antibody 19425-1-AP | Download protocol |
IF protocol for COX16 antibody 19425-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Mol Cell Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery | ||
Nat Commun The HSP90/R2TP assembly chaperone promotes cell proliferation in the intestinal epithelium. | ||
Elife COX16 promotes COX2 metallation and assembly during respiratory complex IV biogenesis.
| ||
J Biol Chem An animal model for mitochondrial tyrosyl-tRNA synthetase deficiency reveals links between oxidative phosphorylation and retinal function. | ||
Redox Biol Lead aggravates Alzheimer's disease pathology via mitochondrial copper accumulation regulated by COX17 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Süleyman (Verified Customer) (02-07-2022) | There are some unspecific bands which were distant but stronger than COX16 itself, even though I loaded 30-40ug of protein and 1.1000 dilution of antibody, either HeLa cells have very low abundant or antibody has some problems.
![]() |