COX16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX16 Polyclonal antibody (19425-1-AP)

• Featured Product
• KD/KO Validated

COX16 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19425-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C14orf112, COX 16, hCOX16, HSPC203, MC4DN22

• 

  WB analysis using 19425-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19425-1-AP (COX16 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 19425-1-AP

  WB result of COX16 antibody (19425-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-COX16 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 19425-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19425-1-AP (COX16 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 19425-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 19425-1-AP (COX16 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 19425-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using COX16 antibody (19425-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, SH-SY5Y cells
• Positive IHC detected in: human stomach tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19425-1-AP targets COX16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13756

  Product name: Recombinant human COX16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC001702

  Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

• Full Name: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC001702
• Gene Symbol: COX16
• Gene ID (NCBI): 51241
• RRID: AB_10666854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0S2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery; Authors - Jasmin Adriana Schafer
human	WB	Nat Commun; Coordination of metal center biogenesis in human cytochrome c oxidase.; Authors - Eva Nývltová
	WB	Nat Commun; The HSP90/R2TP assembly chaperone promotes cell proliferation in the intestinal epithelium.; Authors - Chloé Maurizy
human	WB	Elife; COX16 promotes COX2 metallation and assembly during respiratory complex IV biogenesis.; Authors - Abhishek Aich ; KO Validated
human	WB	J Biol Chem; An animal model for mitochondrial tyrosyl-tRNA synthetase deficiency reveals links between oxidative phosphorylation and retinal function.; Authors - Xiaofen Jin
human	WB	iScience; Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis; Authors - Yunfan He

Reviews

3.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Süleyman (Verified Customer) (02-07-2022)

There are some unspecific bands which were distant but stronger than COX16 itself, even though I loaded 30-40ug of protein and 1.1000 dilution of antibody, either HeLa cells have very low abundant or antibody has some problems.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa

COX16 Antibody Western Blot validation (1:1000 dilution) in HeLa (Cat no:19425-1-AP)