Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, SH-SY5Y cells |
| Positive IHC detected in | human stomach tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19425-1-AP targets COX16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13756 Product name: Recombinant human COX16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC001702 Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT Predict reactive species |
| Full Name | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC001702 |
| Gene Symbol | COX16 |
| Gene ID (NCBI) | 51241 |
| RRID | AB_10666854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P0S2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX16 antibody 19425-1-AP | Download protocol |
| IHC protocol for COX16 antibody 19425-1-AP | Download protocol |
| WB protocol for COX16 antibody 19425-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COX16 polyclonal antibody (Cat# 19425-1-AP) has 7 citations across journals including Nature Communications, Molecular Cell, Redox Biology, iScience, Journal of Biological Chemistry, and eLife. Associated research fields encompass mitochondrial protein import, cytochrome c oxidase assembly and metallation, mitochondrial quality control, oxidative phosphorylation, retinal function, Alzheimer's disease pathology, and metal center biogenesis. All cited applications are Western blot.
| Species | Application | Title |
|---|---|---|
Nat Commun The HSP90/R2TP assembly chaperone promotes cell proliferation in the intestinal epithelium. | ||
Redox Biol Lead aggravates Alzheimer's disease pathology via mitochondrial copper accumulation regulated by COX17 | ||
Mol Cell Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery | ||
iScience Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis | ||
J Biol Chem An animal model for mitochondrial tyrosyl-tRNA synthetase deficiency reveals links between oxidative phosphorylation and retinal function. |
Reviews
What customers say
One reviewer used this antibody at 1:1000 dilution for Western Blot on HeLa cells and reported unspecific bands that were stronger than the COX16 target itself, even with 30–40 µg of protein loaded. They suggested either very low COX16 abundance in HeLa cells or potential specificity issues with the antibody, rating it 3 out of 5 stars.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Süleyman (Verified Customer) (02-07-2022) | There are some unspecific bands which were distant but stronger than COX16 itself, even though I loaded 30-40ug of protein and 1.1000 dilution of antibody, either HeLa cells have very low abundant or antibody has some problems.
 |
