Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, SH-SY5Y cells |
| Positive IHC detected in | human stomach tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
Product Information
19425-1-AP targets COX16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13756 Product name: Recombinant human COX16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC001702 Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT Predict reactive species |
| Full Name | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) |
| Calculated Molecular Weight | 106 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC001702 |
| Gene Symbol | COX16 |
| Gene ID (NCBI) | 51241 |
| RRID | AB_10666854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9P0S2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COX16 antibody 19425-1-AP | Download protocol |
| IHC protocol for COX16 antibody 19425-1-AP | Download protocol |
| WB protocol for COX16 antibody 19425-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery | ||
Nat Commun The HSP90/R2TP assembly chaperone promotes cell proliferation in the intestinal epithelium. | ||
Elife COX16 promotes COX2 metallation and assembly during respiratory complex IV biogenesis.
| ||
J Biol Chem An animal model for mitochondrial tyrosyl-tRNA synthetase deficiency reveals links between oxidative phosphorylation and retinal function. | ||
iScience Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Süleyman (Verified Customer) (02-07-2022) | There are some unspecific bands which were distant but stronger than COX16 itself, even though I loaded 30-40ug of protein and 1.1000 dilution of antibody, either HeLa cells have very low abundant or antibody has some problems.
![]() |










