Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

COX16 Polyclonal antibody

COX16 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

C14orf112, COX 16, hCOX16, HSPC203, MC4DN22

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for COX16 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells, SH-SY5Y cells
Positive IHC detected inhuman stomach tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19425-1-AP targets COX16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13756

Product name: Recombinant human COX16 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-106 aa of BC001702

Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

Predict reactive species
Full Name COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
Calculated Molecular Weight 106 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC001702
Gene Symbol COX16
Gene ID (NCBI) 51241
RRIDAB_10666854
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9P0S2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for COX16 antibody 19425-1-APDownload protocol
IHC protocol for COX16 antibody 19425-1-APDownload protocol
WB protocol for COX16 antibody 19425-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The COX16 polyclonal antibody (Cat# 19425-1-AP) has 7 citations across journals including Nature Communications, Molecular Cell, Redox Biology, iScience, Journal of Biological Chemistry, and eLife. Associated research fields encompass mitochondrial protein import, cytochrome c oxidase assembly and metallation, mitochondrial quality control, oxidative phosphorylation, retinal function, Alzheimer's disease pathology, and metal center biogenesis. All cited applications are Western blot.

SpeciesApplicationTitle
WB

Nat Commun

The HSP90/R2TP assembly chaperone promotes cell proliferation in the intestinal epithelium.

Authors - Chloé Maurizy
humanWB

Nat Commun

Coordination of metal center biogenesis in human cytochrome c oxidase.

Authors - Eva Nývltová
mouseWB

Redox Biol

Lead aggravates Alzheimer's disease pathology via mitochondrial copper accumulation regulated by COX17

Authors - Dingbang Huang
humanWB

Mol Cell

Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery

Authors - Jasmin Adriana Schafer
humanWB

iScience

Deficient tRNA posttranscription modification dysregulated the mitochondrial quality controls and apoptosis

Authors - Yunfan He
humanWB

J Biol Chem

An animal model for mitochondrial tyrosyl-tRNA synthetase deficiency reveals links between oxidative phosphorylation and retinal function.

Authors - Xiaofen Jin

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer used this antibody at 1:1000 dilution for Western Blot on HeLa cells and reported unspecific bands that were stronger than the COX16 target itself, even with 30–40 µg of protein loaded. They suggested either very low COX16 abundance in HeLa cells or potential specificity issues with the antibody, rating it 3 out of 5 stars.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Süleyman (Verified Customer) (02-07-2022)

There are some unspecific bands which were distant but stronger than COX16 itself, even though I loaded 30-40ug of protein and 1.1000 dilution of antibody, either HeLa cells have very low abundant or antibody has some problems.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa
COX16 Antibody Western Blot validation (1:1000 dilution) in HeLa (Cat no:19425-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...