Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11437-1-AP targets COX6B2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1983 Product name: Recombinant human COX6B2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC064548 Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIb polypeptide 2 (testis) |
| Calculated Molecular Weight | 88 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC064548 |
| Gene Symbol | COX6B2 |
| Gene ID (NCBI) | 125965 |
| RRID | AB_10859092 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6YFQ2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX6B2(Cytochrome c oxidase subunit 6B2) encodes the testis-specific cytochrome C oxidase subunit VIb. It has been shown to be expressed in a subset of lung and breast tumors at a level >1% of the testicular level of expression(PMID: 24491090). It belongs to the cytochrome c oxidase subunit 6B family.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX6B2 antibody 11437-1-AP | Download protocol |
| WB protocol for COX6B2 antibody 11437-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Medium Composition Determines the Dynamics of Boar In Vitro Sperm Capacitation-Associated Events. | ||
Biomaterials Spatiotemporal 4D-printed shape-memory scaffold with a triple-acting liposomal strategy for the treatment of infectious bone defects. | ||
Cell Death Dis TMEM232 is required for the formation of sperm flagellum and male fertility in mice |





