Tested Applications
Positive WB detected in | mouse testis tissue, rat testis tissue |
Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
11437-1-AP targets COX6B2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1983 Product name: Recombinant human COX6B2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC064548 Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI Predict reactive species |
Full Name | cytochrome c oxidase subunit VIb polypeptide 2 (testis) |
Calculated Molecular Weight | 88 aa, 11 kDa |
Observed Molecular Weight | 11 kDa |
GenBank Accession Number | BC064548 |
Gene Symbol | COX6B2 |
Gene ID (NCBI) | 125965 |
RRID | AB_10859092 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6YFQ2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX6B2(Cytochrome c oxidase subunit 6B2) encodes the testis-specific cytochrome C oxidase subunit VIb. It has been shown to be expressed in a subset of lung and breast tumors at a level >1% of the testicular level of expression(PMID: 24491090). It belongs to the cytochrome c oxidase subunit 6B family.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COX6B2 antibody 11437-1-AP | Download protocol |
IHC protocol for COX6B2 antibody 11437-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Dis TMEM232 is required for the formation of sperm flagellum and male fertility in mice |