Tested Applications
Positive WB detected in | human heart tissue |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
11429-2-AP targets COX6C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1982 Product name: Recombinant human COX6C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC000187 Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK Predict reactive species |
Full Name | cytochrome c oxidase subunit VIc |
Calculated Molecular Weight | 75 aa, 9 kDa |
Observed Molecular Weight | 9 kDa |
GenBank Accession Number | BC000187 |
Gene Symbol | COX6C |
Gene ID (NCBI) | 1345 |
RRID | AB_2276720 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P09669 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase (COX) is the terminal oxidase in the respiratory chain in human and other mammalian cells. The enzyme is composed of 13 different subunits. COX6C(Cytochrome c oxidase subunit 6C) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COX6C antibody 11429-2-AP | Download protocol |
IHC protocol for COX6C antibody 11429-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |