COX7A1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 11413-1-AP (same clone as 11413-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11413-1-AP (COX7A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11413-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11413-1-AP (same clone as 11413-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11413-1-AP (COX7A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11413-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 11413-1-AP (same clone as 11413-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11413-1-AP (COX7A1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11413-1-AP (same clone as 11413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11413-1-AP (COX7A1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11413-1-PBS in a different storage buffer formulation.

COX7A1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11413-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11413-1-PBS targets COX7A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1981

  Product name: Recombinant human COX7A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC002757

  Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN

• Full Name: cytochrome c oxidase subunit VIIa polypeptide 1 (muscle)
• Calculated Molecular Weight: 79 aa, 9 kDa
• Observed Molecular Weight: 7-9 kDa
• GenBank Accession Number: BC002757
• Gene Symbol: COX7A1
• Gene ID (NCBI): 1346
• RRID: AB_2085705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24310
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytochrome c oxidase(COX) catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen. Subunit VIIa of mammalian COX exists in at least 2 isoforms, liver and muscle. COX7A1(Cytochrome c oxidase subunit 7A1, mitochondrial) is also named as COX7AH, cytochrome c oxidase subunit VIIa-H, cytochrome c oxidase subunit VIIa-M and is the muscle isoform of COX subunit VIIa. Northern-blot analysis of primate tissues demonstrated that COXVIIa-M mRNA is present only in muscle tissues(PMID:1327965).